Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAG-3, Human (HEK293, mFc)

LAG-3 (lymphocyte activating gene 3) protein is an inhibitory receptor on antigen-activated T cells and is critical for immune regulation. LAG-3 binds to FGL1 and transmits inhibitory signals that negatively affect CD8 (+) and CD4 (+) T cell proliferation, activation, and effector functions. LAG-3 Protein, Human (HEK293, mFc) is the recombinant human-derived LAG-3 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

LAG-3 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lag-3-protein-human-hek-293-mfc.html

Smiles

LQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHL

Molecular Formula

3902 (Gene_ID) P18627-1 (L23-L450) (Accession)

Molecular Weight

Approximately 90 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RFPL3S CRISPRa sgRNA lentivector (set of three targets)(Human)
38868121 3x 1.0µg DNA

RFPL3S CRISPRa sgRNA lentivector (set of three targets)(Human)

Ask
View Details
FBXW5 Polyclonal Antibody, HRP Conjugated
bs-9083R-HRP 100 µL

FBXW5 Polyclonal Antibody, HRP Conjugated

Ask
View Details
Human Ephrin Type A Receptor 4 (EPHA4) ELISA Kit
EKN49469 96 Tests

Human Ephrin Type A Receptor 4 (EPHA4) ELISA Kit

Ask
View Details
PDK3 antibody - N-terminal region
MBS3208070-01 0.1 mL

PDK3 antibody - N-terminal region

Ask
View Details
PDK3 antibody - N-terminal region
MBS3208070-02 5x 0.1 mL

PDK3 antibody - N-terminal region

Ask
View Details