Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAG-3, Human (HEK293, mFc)

LAG-3 (lymphocyte activating gene 3) protein is an inhibitory receptor on antigen-activated T cells and is critical for immune regulation. LAG-3 binds to FGL1 and transmits inhibitory signals that negatively affect CD8 (+) and CD4 (+) T cell proliferation, activation, and effector functions. LAG-3 Protein, Human (HEK293, mFc) is the recombinant human-derived LAG-3 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

LAG-3 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lag-3-protein-human-hek-293-mfc.html

Smiles

LQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHL

Molecular Formula

3902 (Gene_ID) P18627-1 (L23-L450) (Accession)

Molecular Weight

Approximately 90 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Goat Keratin-associated protein 3-1, KRTAP3-1 ELISA Kit
MBS9337510 Inquire

Goat Keratin-associated protein 3-1, KRTAP3-1 ELISA Kit

Ask
View Details
SLC27A3 (Solute Carrier Family 27 Member 3, Long-chain Fatty Acid Transport Protein 3, Fatty Acid Transport Protein 3, FATP3, FATP-3, Very Long-chain Acyl-CoA Synthetase Homolog 3, VLCS-3, ACSVL3, PSEC0067, UNQ367/PRO703) (APC)
133462-APC 100 µL

SLC27A3 (Solute Carrier Family 27 Member 3, Long-chain Fatty Acid Transport Protein 3, Fatty Acid Transport Protein 3, FATP3, FATP-3, Very Long-chain Acyl-CoA Synthetase Homolog 3, VLCS-3, ACSVL3, PSEC0067, UNQ367/PRO703) (APC)

Ask
View Details
Sheep C-terminal pro Endothelin 1 ELISA Kit
MBS7272886-01 48 Well

Sheep C-terminal pro Endothelin 1 ELISA Kit

Ask
View Details
Sheep C-terminal pro Endothelin 1 ELISA Kit
MBS7272886-02 96 Well

Sheep C-terminal pro Endothelin 1 ELISA Kit

Ask
View Details
Sheep C-terminal pro Endothelin 1 ELISA Kit
MBS7272886-03 5x 96 Well

Sheep C-terminal pro Endothelin 1 ELISA Kit

Ask
View Details
Sheep C-terminal pro Endothelin 1 ELISA Kit
MBS7272886-04 10x 96 Well

Sheep C-terminal pro Endothelin 1 ELISA Kit

Ask
View Details