Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD43, Human (HEK293, His)

CD43 protein is an important leukocyte surface sialic acid protein that plays a key role in T cell regulation. It has a positive impact on T cell function, including activation, proliferation, differentiation, trafficking and migration, especially by helping T cells migrate to lymph nodes through ERM proteins. CD43 Protein, Human (HEK293, His) is the recombinant human-derived CD43 protein, expressed by HEK293 , with C-8*His labeled tag.

Product Specifications

Product Name Alternative

CD43 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd43-protein-human-hek293-his.html

Purity

95.0

Smiles

STTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSR

Molecular Formula

6693 (Gene_ID) P16150 (S20-R253) (Accession)

Molecular Weight

50-120 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Toll-Like Receptor 9 (TLR9) Antibody
abx027559-01 80 µL

Toll-Like Receptor 9 (TLR9) Antibody

Sign In for Pricing
View Details
Toll-Like Receptor 9 (TLR9) Antibody
abx027559-02 400 µL

Toll-Like Receptor 9 (TLR9) Antibody

Sign In for Pricing
View Details
CYP24A1 Rabbit pAb
MBS8544594-01 0.1 mL

CYP24A1 Rabbit pAb

Sign In for Pricing
View Details
CYP24A1 Rabbit pAb
MBS8544594-02 0.1 mL (AF405L)

CYP24A1 Rabbit pAb

Sign In for Pricing
View Details
CYP24A1 Rabbit pAb
MBS8544594-03 0.1 mL (AF405S)

CYP24A1 Rabbit pAb

Sign In for Pricing
View Details
CYP24A1 Rabbit pAb
MBS8544594-04 0.1 mL (AF610)

CYP24A1 Rabbit pAb

Sign In for Pricing
View Details