Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TrkA, Canine (HEK293, His)

TrkA Protein (isoform 3) belongs to the nerve growth factor receptor family and can promote angiogenesis and has carcinogenic activity when overexpressed. TrkA Protein (isoform 3) antagonizes the anti-proliferative NGF-NTRK1 signaling that promotes the differentiation of neuronal precursors. TrkA Protein, Canine (HEK293, His) is the recombinant canine-derived TrkA protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

TrkA Protein, Canine (HEK293, His), Canine, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trka-protein-canine-hek293-his.html

Purity

95.00

Smiles

PASVQLHEAVELHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPVANETVRHGCLRLNQPTHVNNGNYTLLAANPSGRAAAFVMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSGDPVEK

Molecular Formula

490404 (Gene_ID) A0A8I3P078/XP_851619.3 (P285-K410) (Accession)

Molecular Weight

Approximately 20-42 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Collagen 4 alpha 2 Blocking Peptide
MBS8226927-01 1 mg

Collagen 4 alpha 2 Blocking Peptide

Sign In for Pricing
View Details
Collagen 4 alpha 2 Blocking Peptide
MBS8226927-02 5 mg

Collagen 4 alpha 2 Blocking Peptide

Sign In for Pricing
View Details
Collagen 4 alpha 2 Blocking Peptide
MBS8226927-03 5x 5 mg

Collagen 4 alpha 2 Blocking Peptide

Sign In for Pricing
View Details
Mouse SKA2 siRNA
abx933436-01 15 nmol

Mouse SKA2 siRNA

Sign In for Pricing
View Details
Mouse SKA2 siRNA
abx933436-02 30 nmol

Mouse SKA2 siRNA

Sign In for Pricing
View Details
Interferon regulatory Factor 6 (IRF6) Mouse ELISA Kit
E3441 96 Tests

Interferon regulatory Factor 6 (IRF6) Mouse ELISA Kit

Sign In for Pricing
View Details