Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3 epsilon, Human (HEK293, His)

CD3 epsilon is an important component of the TCR-CD3 complex on T lymphocytes and promotes TCR-mediated signaling. When APC activates the TCR, CD3 epsilon, together with CD3D, CD3G, and CD3Z, transmits signals across the cell membrane through ITAMs. CD3 epsilon Protein, Human (HEK293, His) is the recombinant human-derived CD3 epsilon protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD3 epsilon Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd3-epsilon-protein-human-hek-293-his.html

Purity

97.00

Smiles

DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD

Molecular Formula

916 (Gene_ID) P07766 (D23-D126) (Accession)

Molecular Weight

Approximately 18-21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCNA Polyclonal Antibody
UB-GEN-16179 100 µL

PCNA Polyclonal Antibody

Sign In for Pricing
View Details
P2RY2, CT (P2RY2, P2RU1, P2Y purinoceptor 2, ATP receptor, P2U purinoceptor 1, Purinergic receptor) (MaxLight 490) discontinued
039586-ML490 100 µL

P2RY2, CT (P2RY2, P2RU1, P2Y purinoceptor 2, ATP receptor, P2U purinoceptor 1, Purinergic receptor) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Human DNAJC22 knockdown cell line
ABC-KD4311 1 Vial

Human DNAJC22 knockdown cell line

Sign In for Pricing
View Details
SaniHol ST 70%
25769-1 4x 1 Gal

SaniHol ST 70%

Sign In for Pricing
View Details
Mouse Interleukin 12A (IL35) CLIA Kit
abx197195-01 96 Tests

Mouse Interleukin 12A (IL35) CLIA Kit

Sign In for Pricing
View Details
Mouse Interleukin 12A (IL35) CLIA Kit
abx197195-02 5x 96 Tests

Mouse Interleukin 12A (IL35) CLIA Kit

Sign In for Pricing
View Details