Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3 epsilon, Human (HEK293, His)

CD3 epsilon is an important component of the TCR-CD3 complex on T lymphocytes and promotes TCR-mediated signaling. When APC activates the TCR, CD3 epsilon, together with CD3D, CD3G, and CD3Z, transmits signals across the cell membrane through ITAMs. CD3 epsilon Protein, Human (HEK293, His) is the recombinant human-derived CD3 epsilon protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD3 epsilon Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd3-epsilon-protein-human-hek-293-his.html

Purity

97.00

Smiles

DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD

Molecular Formula

916 (Gene_ID) P07766 (D23-D126) (Accession)

Molecular Weight

Approximately 18-21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100A10 AAV Vector (Human) (CMV)
42924101 1 µg

S100A10 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
PE-Labeled Monoclonal Anti-Human CD19 Antibody, Mouse IgG2a (FMC63)
FM3-PCFM7-25tests 25 Tests

PE-Labeled Monoclonal Anti-Human CD19 Antibody, Mouse IgG2a (FMC63)

Sign In for Pricing
View Details
Goat DNA binding protein (DBP) ELISA Kit
EIA05562Go 1 Kit

Goat DNA binding protein (DBP) ELISA Kit

Sign In for Pricing
View Details
PSMB8 Rabbit Polyclonal Antibody
TA339265 100 µL

PSMB8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OR7E22P ORF Vector (Human) (pORF)
ORF027154 1.0 µg DNA

OR7E22P ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
TLR2
337303-01 50 µL

TLR2

Sign In for Pricing
View Details