Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3 epsilon, Human (HEK293, His)

CD3 epsilon is an important component of the TCR-CD3 complex on T lymphocytes and promotes TCR-mediated signaling. When APC activates the TCR, CD3 epsilon, together with CD3D, CD3G, and CD3Z, transmits signals across the cell membrane through ITAMs. CD3 epsilon Protein, Human (HEK293, His) is the recombinant human-derived CD3 epsilon protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD3 epsilon Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd3-epsilon-protein-human-hek-293-his.html

Purity

97.00

Smiles

DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD

Molecular Formula

916 (Gene_ID) P07766 (D23-D126) (Accession)

Molecular Weight

Approximately 18-21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBX30 Rabbit Polyclonal Antibody
JOT-AP02648-01 50ul

FBX30 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FBX30 Rabbit Polyclonal Antibody
JOT-AP02648-02 100ul

FBX30 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Olfr61 Double Nickase Plasmid (m2)
sc-422050-NIC-2 20 µg

Olfr61 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
TRNAA19 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2474006 1.0 µg DNA

TRNAA19 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
TROY (TNFRSF19) (NM_148957) Human Untagged Clone
SC306336 10 µg

TROY (TNFRSF19) (NM_148957) Human Untagged Clone

Sign In for Pricing
View Details
RN5S426 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV745341 1.0 µg DNA

RN5S426 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details