Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3 epsilon, Human (HEK293, His)

CD3 epsilon is an important component of the TCR-CD3 complex on T lymphocytes and promotes TCR-mediated signaling. When APC activates the TCR, CD3 epsilon, together with CD3D, CD3G, and CD3Z, transmits signals across the cell membrane through ITAMs. CD3 epsilon Protein, Human (HEK293, His) is the recombinant human-derived CD3 epsilon protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD3 epsilon Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd3-epsilon-protein-human-hek-293-his.html

Purity

97.00

Smiles

DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD

Molecular Formula

916 (Gene_ID) P07766 (D23-D126) (Accession)

Molecular Weight

Approximately 18-21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Β-citryl-glutamate Synthase B (RIMKLB) Mouse ELISA Kit
B8434 96 Tests

Β-citryl-glutamate Synthase B (RIMKLB) Mouse ELISA Kit

Sign In for Pricing
View Details
C9orf72 Antibody Blocking Peptide - (Dry Ice)
NBP2-47146PEP 0.1 mg

C9orf72 Antibody Blocking Peptide - (Dry Ice)

Sign In for Pricing
View Details
Uqcc2 (NM_001108528) Rat Tagged ORF Clone Lentiviral Particle
RR210575L3V 200 µL

Uqcc2 (NM_001108528) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
FGF16 Antibody
A21893-100UL 100 µL

FGF16 Antibody

Sign In for Pricing
View Details
AMSH (STAMBP) (NM_201647) Human 3' UTR Clone
SC208405 10 µg

AMSH (STAMBP) (NM_201647) Human 3' UTR Clone

Sign In for Pricing
View Details
FRA13D 3'UTR Luciferase Stable Cell Line
TU008244 1.0 mL

FRA13D 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details