Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3 epsilon, Human (HEK293, His)

CD3 epsilon is an important component of the TCR-CD3 complex on T lymphocytes and promotes TCR-mediated signaling. When APC activates the TCR, CD3 epsilon, together with CD3D, CD3G, and CD3Z, transmits signals across the cell membrane through ITAMs. CD3 epsilon Protein, Human (HEK293, His) is the recombinant human-derived CD3 epsilon protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD3 epsilon Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd3-epsilon-protein-human-hek-293-his.html

Purity

97.00

Smiles

DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD

Molecular Formula

916 (Gene_ID) P07766 (D23-D126) (Accession)

Molecular Weight

Approximately 18-21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

STC1 protein, Human, Recombinant (His)
E51P90538 20 µg

STC1 protein, Human, Recombinant (His)

Sign In for Pricing
View Details
P21 Recombinant Mouse monoclonal Antibody
HA610098 100 µg

P21 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
2-chloro-4-ethynyl-1- (trifluoromethyl) benzene
JH916422 1 Each

2-chloro-4-ethynyl-1- (trifluoromethyl) benzene

Sign In for Pricing
View Details
Slc39a8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
44190114 3x 1.0 µg

Slc39a8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
LOC100302372 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV645381 1.0 µg DNA

LOC100302372 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Tarazepide
MF-0030339-01 25 mg

Tarazepide

Sign In for Pricing
View Details