CD3 epsilon, Human (HEK293, His)
CD3 epsilon is an important component of the TCR-CD3 complex on T lymphocytes and promotes TCR-mediated signaling. When APC activates the TCR, CD3 epsilon, together with CD3D, CD3G, and CD3Z, transmits signals across the cell membrane through ITAMs. CD3 epsilon Protein, Human (HEK293, His) is the recombinant human-derived CD3 epsilon protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
CD3 epsilon Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd3-epsilon-protein-human-hek-293-his.html
Purity
97.00
Smiles
DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD
Molecular Formula
916 (Gene_ID) P07766 (D23-D126) (Accession)
Molecular Weight
Approximately 18-21 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
SDR39U1, NT (SDR39U1, C14orf124, HCDI, Epimerase family protein SDR39U1, Short-chain dehydrogenase/reductase family 39U member 1) (MaxLight 405) discontinued
FOXJ2 (Forkhead Box Protein J2, Fork Head Homologous X, FHX) APC
FOXJ2 (Forkhead Box Protein J2, Fork Head Homologous X, FHX) APC
