Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3 epsilon, Human (HEK293, His)

CD3 epsilon is an important component of the TCR-CD3 complex on T lymphocytes and promotes TCR-mediated signaling. When APC activates the TCR, CD3 epsilon, together with CD3D, CD3G, and CD3Z, transmits signals across the cell membrane through ITAMs. CD3 epsilon Protein, Human (HEK293, His) is the recombinant human-derived CD3 epsilon protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD3 epsilon Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd3-epsilon-protein-human-hek-293-his.html

Purity

97.00

Smiles

DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD

Molecular Formula

916 (Gene_ID) P07766 (D23-D126) (Accession)

Molecular Weight

Approximately 18-21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CACNG4 Recombinant Protein Antigen
NBP2-55863PEP 100 µL

CACNG4 Recombinant Protein Antigen

Sign In for Pricing
View Details
Becn1 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4460403 1.0 µg DNA

Becn1 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
CLK1 (NM_001162407) Human Tagged Lenti ORF Clone
RC228428L4 10 µg

CLK1 (NM_001162407) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
DTYMK (Thymidylate Kinase, dTMP Kinase, CDC8, TMPK, TYMK) (AP) discontinued
126045-AP 100 µL

DTYMK (Thymidylate Kinase, dTMP Kinase, CDC8, TMPK, TYMK) (AP) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal PAPSS2 Antibody
NBP1-33726 100 µL

Rabbit Polyclonal PAPSS2 Antibody

Sign In for Pricing
View Details
Fibroblast Growth Factor Binding Protein 3 (FGFBP3) Antibody
abx215349-01 50 µg

Fibroblast Growth Factor Binding Protein 3 (FGFBP3) Antibody

Sign In for Pricing
View Details