Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3 epsilon, Human (HEK293, His)

CD3 epsilon is an important component of the TCR-CD3 complex on T lymphocytes and promotes TCR-mediated signaling. When APC activates the TCR, CD3 epsilon, together with CD3D, CD3G, and CD3Z, transmits signals across the cell membrane through ITAMs. CD3 epsilon Protein, Human (HEK293, His) is the recombinant human-derived CD3 epsilon protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD3 epsilon Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd3-epsilon-protein-human-hek-293-his.html

Purity

97.00

Smiles

DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD

Molecular Formula

916 (Gene_ID) P07766 (D23-D126) (Accession)

Molecular Weight

Approximately 18-21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BeyoMagTM Anti-Flag Magnetic Beads
P2115-0.5ml 0.5 mL

BeyoMagTM Anti-Flag Magnetic Beads

Sign In for Pricing
View Details
GALNT14 Antibody
A62637-100UG 100 µg

GALNT14 Antibody

Sign In for Pricing
View Details
Factor H Antibody FITC Conjugated
MBS9461972-01 0.1 mL

Factor H Antibody FITC Conjugated

Sign In for Pricing
View Details
Factor H Antibody FITC Conjugated
MBS9461972-02 5x 0.1 mL

Factor H Antibody FITC Conjugated

Sign In for Pricing
View Details
BCL2L2 Human shRNA Lentiviral Particle (Locus ID 599)
TL316462V 500 µL Each

BCL2L2 Human shRNA Lentiviral Particle (Locus ID 599)

Sign In for Pricing
View Details
Nestin (NES) Mouse Monoclonal Antibody [Clone ID: OTI8C4]
TA814282S 30 µL

Nestin (NES) Mouse Monoclonal Antibody [Clone ID: OTI8C4]

Sign In for Pricing
View Details