Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Mouse (CHO)

IL-1 beta is a potent proinflammatory cytokine expressed by monocytes, macrophages, and dendritic cells. IL-1 beta plays a key role in inflammation and immunologic reactions[1][2]. IL-1 beta Protein, Mouse (CHO) is produced in CHO cells, and consists of 152 amino acids (V118-S269) .

Product Specifications

Product Name Alternative

IL-1 beta Protein, Mouse (CHO), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-mouse-cho.html

Purity

96.00

Smiles

VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS

Molecular Formula

16176 (Gene_ID) P10749 (V118-S269) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Jan Petrasek, et al. IL-1 receptor antagonist ameliorates inflammasome-dependent alcoholic steatohepatitis in mice. J Clin Invest. 2012 Oct;122 (10) :3476-89.|[2]Karina Zitta, et al. Interleukin-1beta regulates cell proliferation and activity of extracellular matrix remodelling enzymes in cultured primary pig heart cells. Biochem Biophys Res Commun. 2010 Sep 3;399 (4) :542-7.|[3]Kenichi Shimada, et al. Caspase-1 dependent IL-1β secretion is critical for host defense in a mouse model of Chlamydia pneumoniae lung infection. PLoS One. 2011;6 (6) :e21477.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Frozen Tissue Blocks, Stomach
CB502785 1 Block

Frozen Tissue Blocks, Stomach

Ask
View Details
Mouse Monoclonal Galectin-7 Antibody (950723) [DyLight 594]
FAB13392M 0.1 mL

Mouse Monoclonal Galectin-7 Antibody (950723) [DyLight 594]

Ask
View Details
Vipas39 (NM_001142580) Mouse Tagged ORF Clone Lentiviral Particle
MR225891L3V 200 µL

Vipas39 (NM_001142580) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
GPXP2 CRISPR Knock Out 293T Cell Line (Human)
58342141 1x 10^6 Cells / 1.0 mL

GPXP2 CRISPR Knock Out 293T Cell Line (Human)

Ask
View Details
TTC35 (EMC2) (NM_014673) Human Recombinant Protein
TP304770M 100 µg

TTC35 (EMC2) (NM_014673) Human Recombinant Protein

Ask
View Details
H1N1 Puerto Rico Recombinant
32-13631-2 2 µg

H1N1 Puerto Rico Recombinant

Ask
View Details