PVR/CD155, Human (HEK293, His)
PVR/CD155 Protein, Human (HEK293, His) is a recombinant Human PVR expressed in HEK 293 cells with a His tag at the N-terminus. PVR, Human plays a role in cancer cell invasion and migration[1][2].
Product Specifications
Product Name Alternative
PVR/CD155 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/pvr-protein-human-hek-293-his.html
Purity
95.0
Smiles
WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGMSRN
Molecular Formula
5817 (Gene_ID) NP_006496 (W21-N343) (Accession)
Molecular Weight
Approximately 58.0 kDa
References & Citations
[1]Mandai K, et, al. Nectins and nectin-like molecules in development and disease. Curr Top Dev Biol. 2015;112:197-231.|[2]Ravens I, et, al. Characterization and identification of Tage4 as the murine orthologue of human poliovirus receptor/CD155. Biochem Biophys Res Commun. 2003 Dec 26;312 (4) :1364-71.
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1302519-01 0.02 mg (E-Coli)
Recombinant Rickettsia felis Putative ankyrin repeat protein RF_0939 (RF_0939)
Sign In for Pricing
View Details MBS1302519-02 0.1 mg (E-Coli)
Recombinant Rickettsia felis Putative ankyrin repeat protein RF_0939 (RF_0939)
Sign In for Pricing
View Details MBS1302519-03 0.02 mg (Yeast)
Recombinant Rickettsia felis Putative ankyrin repeat protein RF_0939 (RF_0939)
Sign In for Pricing
View Details