Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPARC, Human

SPARC Protein, Human is a Ca2+-binding glycoprotein that is differentially associated with morphogenesis, remodeling, cellular migration, and proliferation.

Product Specifications

Product Name Alternative

SPARC Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/sparc-protein-human.html

Purity

95.00

Smiles

APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI

Molecular Formula

6678 (Gene_ID) P09486 (A18-I303) (Accession)

Molecular Weight

Approximately 36.1 kDa

References & Citations

[1]Sage H, et al. SPARC, a secreted protein associated with cellular proliferation, inhibits cell spreading in vitro and exhibits Ca+2-dependent binding to the extracellular matrix. J Cell Biol. 1989 Jul;109 (1) :341-56.|[2]Alford AI, et al. Matricellular proteins: Extracellular modulators of bone development, remodeling, and regeneration. Bone. 2006 Jun;38 (6) :749-57.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IL24 Protein, N-His
bs-101882P-01 20 µg

Recombinant Human IL24 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human IL24 Protein, N-His
bs-101882P-02 50 µg

Recombinant Human IL24 Protein, N-His

Sign In for Pricing
View Details
Calcifediol-D6
C04901-1mg 1 mg

Calcifediol-D6

Sign In for Pricing
View Details
Floribundone 1
HY-N3898 1 Each

Floribundone 1

Sign In for Pricing
View Details
ORAI1 Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-61611R-BF680-01 20 µL

ORAI1 Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
ORAI1 Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-61611R-BF680-02 100 µL

ORAI1 Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details