Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NADPH oxidase 1 (NOX1)

Product Specifications

Product Name Alternative

Mitogenic oxidase 1 (MOX-1) (NADH/NADPH mitogenic oxidase subunit P65-MOX) (NOH-1)

Abbreviation

Recombinant Human NOX1 protein

Gene Name

NOX1

UniProt

Q9Y5S8

Expression Region

1-564aa

Organism

Homo sapiens (Human)

Target Sequence

MGNWVVNHWFSVLFLVVWLGLNVFLFVDAFLKYEKADKYYYTRKILGSTLACARASALCLNFNSTLILLPVCRNLLSFLRGTCSFCSRTLRKQLDHNLTFHKLVAYMICLHTAIHIIAHLFNFDCYSRSRQATDGSLASILSSLSHDEKKGGSWLNPIQSRNTTVEYVTFTSIAGLTGVIMTIALILMVTSATEFIRRSYFEVFWYTHHLFIFYILGLGIHGIGGIVRGQTEESMNESHPRKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILYICERILRFYRSQQKVVITKVVMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPFTLTSAPEEDFFSIHIRAAGDWTENLIRAFEQQYSPIPRIEVDGPFGTASEDVFQYEVAVLVGAGIGVTPFASILKSIWYKFQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSNIVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF

Tag

N-terminal 10xHis-tagged

Type

CF Transmembrane Protein & In Stock Protein

Source

In vitro E.coli expression system

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

67.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C9 (C9) (184-411) Rabbit Polyclonal Antibody
AP23617PU-N 50 µL

Complement C9 (C9) (184-411) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human C20orf117 (SOGA1) activation kit by CRISPRa
GA115397 1 Kit

Human C20orf117 (SOGA1) activation kit by CRISPRa

Sign In for Pricing
View Details
PGP9.5 Antibody
KC-6133-01 50 μL

PGP9.5 Antibody

Sign In for Pricing
View Details
PGP9.5 Antibody
KC-6133-02 100 µL

PGP9.5 Antibody

Sign In for Pricing
View Details
PGP9.5 Antibody
KC-6133-03 1 mL

PGP9.5 Antibody

Sign In for Pricing
View Details
TentaGel® HL Bromo Acetal
HL12019.100G 100 g

TentaGel® HL Bromo Acetal

Sign In for Pricing
View Details