Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

T-PA, Mouse (HEK293, Fc)

The T-PA protein converts the inactive plasminogen to active plasmin by hydrolyzing a single Arg-Val bond.This conversion regulates plasmin-mediated proteolysis and is involved in tissue remodeling, degradation, and cell migration.T-PA also contributes to the prevention of polyspermy during oocyte activation by participating in the cortical granule reaction.T-PA Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived T-PA protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

T-PA Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/t-pa-protein-mouse-hek293-fc.html

Purity

91.00

Smiles

IKGGLYTDITSHPWQAAIFVKNKRSPGERFLCGGVLISSCWVLSAAHCFLERFPPNHLKVVLGRTYRVVPGEEEQTFEIEKYIVHEEFDDDTYDNDIALLQLRSQSKQCAQESSSVGTACLPDPNLQLPDWTECELSGYGKHEASSPFFSDRLKEAHVRLYPSSRCTSQHLFNKTVTNNMLCAGDTRSGGNQDLHDACQGDSGGPLVCMINKQMTLTGIISWGLGCGQKDVPGVYTKVTNYLDWIHDNMKQ

Molecular Formula

18791 (Gene_ID) P11214 (I309-Q559) (Accession)

Molecular Weight

55-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PD-L1 (CD274) Human Recombinant Protein
TP727742 10 µg

PD-L1 (CD274) Human Recombinant Protein

Sign In for Pricing
View Details
Rabbit Anti-IL18 antibody
SL55111R-01 50 µL

Rabbit Anti-IL18 antibody

Sign In for Pricing
View Details
Rabbit Anti-IL18 antibody
SL55111R-02 100 µL

Rabbit Anti-IL18 antibody

Sign In for Pricing
View Details
Rabbit Anti-IL18 antibody
SL55111R-03 200 µL

Rabbit Anti-IL18 antibody

Sign In for Pricing
View Details
KCTD14 sgRNA CRISPR Lentivector (Human) (Target 1)
K1127802 1.0 µg DNA

KCTD14 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
CERS2 discontinued
310542 100 µL

CERS2 discontinued

Sign In for Pricing
View Details