Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Thymopoietin, Human (His)

Thymopoietin protein critically directs nuclear lamina assembly and maintains structural organization in the nuclear envelope. It is considered a potential receptor that attaches lamina fibrils to the inner nuclear membrane, where it anchors key structural components. Thymopoietin Protein, Human (His) is the recombinant human-derived Thymopoietin protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Thymopoietin Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/thymopoietin-protein-human-his.html

Smiles

PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGTNSKGPPDFSSDEEREPTPVLGSGAAAAGRSRAAVGRKATKKTDKPRQEDKDDLDVTELTNEDLLDQLVKYGVNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDSDRYSDNE

Molecular Formula

7112 (Gene_ID) P42167 (M1-E187) (Accession)

Molecular Weight

Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (B-B12), CF770 conjugate, 0.1mg/mL
BNC701052-500 1x 500 µL

CD3e (B-B12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF647 conjugate, 0.1mg/mL
BNC470645-100 1x 100 µL

FOXP3 (3G3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (PCRP-SOX9-1E5), CF405S conjugate, 0.1mg/mL
BNC041926-500 1x 500 µL

SOX9 / SRY-box 9 (PCRP-SOX9-1E5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1798), CF740 conjugate, 0.1mg/mL
BNC741798-500 1x 500 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1798), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (LAMP4/824), CF405S conjugate, 0.1mg/mL
BNC040824-100 1x 100 µL

CD68 (LAMP4/824), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (SOX9/2387), CF594 conjugate, 0.1mg/mL
BNC942387-500 1x 500 µL

SOX9 / SRY-box 9 (SOX9/2387), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details