Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Fibroblast growth factor 2 (Fgf2), partial (Active)

Product Specifications

Product Name Alternative

Fibroblast Growth Factor 2; FGF-2; Basic Fibroblast Growth Factor; bFGF; Heparin-Binding Growth Factor 2; HBGF-2; FGF2; FGFB

Abbreviation

Recombinant Rat Fgf2 protein, partial (Active)

Gene Name

Fgf2

UniProt

P13109

Expression Region

11-154aa

Organism

Rattus norvegicus (Rat)

Target Sequence

ALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

FGF-basic is a members of the Fibroblast Growth Factors (FGFs) family. The family constitutes a large family of proteins involved in many aspects of development including cell proliferation, growth, and differentiation. They act on several cell types to regulate diverse physiologic functions including angiogenesis, cell growth, pattern formation, embryonic development, metabolic regulation, cell migration, neurotrophic effects, and tissue repair. FGF-basic is a non-glycosylated heparin binding growth factor that is expressed in the brain, pituitary, kidney, retina, bone, testis, adrenal gland liver, monocytes, epithelial cells and endothelial cells. FGF-basic signals through FGFR 1b, 1c, 2c, 3c and 4.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is 0.3-1.8 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis.

Molecular Weight

16.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Chlorotrityl Chloride (90%)
TRC-C422260-1G 1 g

2-Chlorotrityl Chloride (90%)

Sign In for Pricing
View Details
CD10 Recombinant Rabbit monoclonal Antibody
HA750273 100 µL

CD10 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
PDCD6 Human Gene Knockout Kit (CRISPR)
KN402030 1 Kit

PDCD6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Gastrodin
TRC-G245550-1G 1 g

Gastrodin

Sign In for Pricing
View Details
6-Amino-3-chloropicolinic Acid
TRC-A595920-500MG 500 mg

6-Amino-3-chloropicolinic Acid

Sign In for Pricing
View Details
Wheat Germ Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Black PS
MTB11F4-WG/W 10x 96 Well Plates

Wheat Germ Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Black PS

Sign In for Pricing
View Details