Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3E-CD3G Heterodimer, Mouse (HEK293, Fc)

CD3E protein has predicted functions such as SH3 domain binding and protein heterodimerization, and plays a crucial role in nervous system development and cell adhesion. It is involved in T cell activation, cytokine production and signal transduction. CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc) is a recombinant protein dimer complex containing mouse-derived CD3E-CD3G Heterodimer protein, expressed by HEK293 , with C-hFc labeled tag. CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc), has molecular weight of ~38-40 kDa.

Product Specifications

Product Name Alternative

CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd3e-cd3g-heterodimer-protein-mouse-hek293-fc.html

Purity

95.0

Smiles

DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD&:QTNKAKNLVQVDGSRGDGSVLLTCGLTDKTIKWLKDGSIISPLNATKNTWNLGNNAKDPRGTYQCQGAKETSNPLQVYYRMCENCIELNIGTIS

Molecular Formula

12501&12502 (Gene_ID) NP_031674.1 (D23-D108) &NP_033980.1 (Q23-S116) (Accession)

Molecular Weight

Approximately 38-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL
BNC040525-100 1x 100 µL

CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL
BNC740460-100 1x 100 µL

CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prostate Specific Antigen (PSA) (3E6), CF594 conjugate, 0.1mg/mL
BNC941777-100 1x 100 µL

Prostate Specific Antigen (PSA) (3E6), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prolactin Receptor (PRLR/742), CF647 conjugate, 0.1mg/mL
BNC470742-500 1x 500 µL

Prolactin Receptor (PRLR/742), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) (KRT19/1959R), CF405S conjugate, 0.1mg/mL
BNC041959-100 1x 100 µL

Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) (KRT19/1959R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (KLC264), CF740 conjugate, 0.1mg/mL
BNC740264-100 1x 100 µL

Human Kappa Light Chain (KLC264), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details