Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3E-CD3G Heterodimer, Mouse (HEK293, Fc)

CD3E protein has predicted functions such as SH3 domain binding and protein heterodimerization, and plays a crucial role in nervous system development and cell adhesion. It is involved in T cell activation, cytokine production and signal transduction. CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc) is a recombinant protein dimer complex containing mouse-derived CD3E-CD3G Heterodimer protein, expressed by HEK293 , with C-hFc labeled tag. CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc), has molecular weight of ~38-40 kDa.

Product Specifications

Product Name Alternative

CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd3e-cd3g-heterodimer-protein-mouse-hek293-fc.html

Purity

95.0

Smiles

DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD&:QTNKAKNLVQVDGSRGDGSVLLTCGLTDKTIKWLKDGSIISPLNATKNTWNLGNNAKDPRGTYQCQGAKETSNPLQVYYRMCENCIELNIGTIS

Molecular Formula

12501&12502 (Gene_ID) NP_031674.1 (D23-D108) &NP_033980.1 (Q23-S116) (Accession)

Molecular Weight

Approximately 38-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMX Antibody
A48294-50UL 50 μL

BMX Antibody

Sign In for Pricing
View Details
HL-100-AL1-R01 (H-3137)
ADC-P-097 Each

HL-100-AL1-R01 (H-3137)

Sign In for Pricing
View Details
C10orf116 ORF Vector (Human) (pORF)
ORF001119 1.0 µg DNA

C10orf116 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Affinity Purified Anti-MOUSE IgG F(ab )2 (RABBIT)
GWB-84AC1A 2 mg

Affinity Purified Anti-MOUSE IgG F(ab )2 (RABBIT)

Sign In for Pricing
View Details
USP24 Polyclonal Antibody
UB-GEN-2765 100 µL

USP24 Polyclonal Antibody

Sign In for Pricing
View Details
IKBKB (FLJ40509, MGC131801, IKKB, Inhibitor of Nuclear Factor kappa-B Kinase Subunit beta, I-kappa-B Kinase 2, Nuclear Factor NF-kappa-B Inhibitor Kinase beta) (MaxLight 550)
128366-ML550 100 µL

IKBKB (FLJ40509, MGC131801, IKKB, Inhibitor of Nuclear Factor kappa-B Kinase Subunit beta, I-kappa-B Kinase 2, Nuclear Factor NF-kappa-B Inhibitor Kinase beta) (MaxLight 550)

Sign In for Pricing
View Details