Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3E-CD3G Heterodimer, Mouse (HEK293, Fc)

CD3E protein has predicted functions such as SH3 domain binding and protein heterodimerization, and plays a crucial role in nervous system development and cell adhesion. It is involved in T cell activation, cytokine production and signal transduction. CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc) is a recombinant protein dimer complex containing mouse-derived CD3E-CD3G Heterodimer protein, expressed by HEK293 , with C-hFc labeled tag. CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc), has molecular weight of ~38-40 kDa.

Product Specifications

Product Name Alternative

CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd3e-cd3g-heterodimer-protein-mouse-hek293-fc.html

Purity

95.0

Smiles

DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD&:QTNKAKNLVQVDGSRGDGSVLLTCGLTDKTIKWLKDGSIISPLNATKNTWNLGNNAKDPRGTYQCQGAKETSNPLQVYYRMCENCIELNIGTIS

Molecular Formula

12501&12502 (Gene_ID) NP_031674.1 (D23-D108) &NP_033980.1 (Q23-S116) (Accession)

Molecular Weight

Approximately 38-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Dusp8 shRNA (UAS) - Lentiviral mouse Dusp8 shRNA (UAS, iRFP) plasmid
GTR15149260 1 Vial

Lentiviral mouse Dusp8 shRNA (UAS) - Lentiviral mouse Dusp8 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Mouse Monoclonal PTPN7 Antibody (OTI3B10) [HRP]
NBP2-73732H 0.1 mL

Mouse Monoclonal PTPN7 Antibody (OTI3B10) [HRP]

Sign In for Pricing
View Details
Striatin-3 (STRN3, Cell Cycle Autoantigen SG2NA GS2NA, S/G2 Antigen, SG2NA) (MaxLight 650)
MBS6224934-01 0.1 mL

Striatin-3 (STRN3, Cell Cycle Autoantigen SG2NA GS2NA, S/G2 Antigen, SG2NA) (MaxLight 650)

Sign In for Pricing
View Details
Striatin-3 (STRN3, Cell Cycle Autoantigen SG2NA GS2NA, S/G2 Antigen, SG2NA) (MaxLight 650)
MBS6224934-02 5x 0.1 mL

Striatin-3 (STRN3, Cell Cycle Autoantigen SG2NA GS2NA, S/G2 Antigen, SG2NA) (MaxLight 650)

Sign In for Pricing
View Details
SERPINA11 Protein Vector (Rat) (pPM-C-HA)
43438027 500 ng

SERPINA11 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
SLC16A2 Rabbit Polyclonal Antibody
TA361244 100 µL

SLC16A2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details