Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3E-CD3G Heterodimer, Mouse (HEK293, Fc)

CD3E protein has predicted functions such as SH3 domain binding and protein heterodimerization, and plays a crucial role in nervous system development and cell adhesion. It is involved in T cell activation, cytokine production and signal transduction. CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc) is a recombinant protein dimer complex containing mouse-derived CD3E-CD3G Heterodimer protein, expressed by HEK293 , with C-hFc labeled tag. CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc), has molecular weight of ~38-40 kDa.

Product Specifications

Product Name Alternative

CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd3e-cd3g-heterodimer-protein-mouse-hek293-fc.html

Purity

95.0

Smiles

DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD&:QTNKAKNLVQVDGSRGDGSVLLTCGLTDKTIKWLKDGSIISPLNATKNTWNLGNNAKDPRGTYQCQGAKETSNPLQVYYRMCENCIELNIGTIS

Molecular Formula

12501&12502 (Gene_ID) NP_031674.1 (D23-D108) &NP_033980.1 (Q23-S116) (Accession)

Molecular Weight

Approximately 38-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFIX Rabbit Polyclonal Antibody
TA379087 100 µL

NFIX Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RPL24 (NM_000986) Human Tagged ORF Clone Lentiviral Particle
RC200689L1V 200 µL

RPL24 (NM_000986) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Bacillus anthracis (Anthrax) antibody
10-B02B 1 mg

Bacillus anthracis (Anthrax) antibody

Sign In for Pricing
View Details
Gram Bacteria DNA Auto Plate
301033 96 Tests

Gram Bacteria DNA Auto Plate

Sign In for Pricing
View Details
Hsa-miR-8089 miRNA Antagomir
CIJ2563-01 10 nmol

Hsa-miR-8089 miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-8089 miRNA Antagomir
CIJ2563-02 20 nmol

Hsa-miR-8089 miRNA Antagomir

Sign In for Pricing
View Details