Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3E-CD3G Heterodimer, Mouse (HEK293, Fc)

CD3E protein has predicted functions such as SH3 domain binding and protein heterodimerization, and plays a crucial role in nervous system development and cell adhesion. It is involved in T cell activation, cytokine production and signal transduction. CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc) is a recombinant protein dimer complex containing mouse-derived CD3E-CD3G Heterodimer protein, expressed by HEK293 , with C-hFc labeled tag. CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc), has molecular weight of ~38-40 kDa.

Product Specifications

Product Name Alternative

CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd3e-cd3g-heterodimer-protein-mouse-hek293-fc.html

Purity

95.0

Smiles

DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD&:QTNKAKNLVQVDGSRGDGSVLLTCGLTDKTIKWLKDGSIISPLNATKNTWNLGNNAKDPRGTYQCQGAKETSNPLQVYYRMCENCIELNIGTIS

Molecular Formula

12501&12502 (Gene_ID) NP_031674.1 (D23-D108) &NP_033980.1 (Q23-S116) (Accession)

Molecular Weight

Approximately 38-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fam71b (NM_001013783) Mouse Tagged ORF Clone
MG212234 10 µg

Fam71b (NM_001013783) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
SCARF2, CT (SCARF2, SREC2, SREPCR, Scavenger receptor class F member 2, SRECRP-1, Scavenger receptor expressed by endothelial cells 2 protein) (MaxLight 405) discontinued
041451-ML405 100 µL

SCARF2, CT (SCARF2, SREC2, SREPCR, Scavenger receptor class F member 2, SRECRP-1, Scavenger receptor expressed by endothelial cells 2 protein) (MaxLight 405) discontinued

Sign In for Pricing
View Details
COMT Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV708873 1.0 µg DNA

COMT Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Lenti-III-GFP-C Kit Complete Kit
LV034 1 Kit

Lenti-III-GFP-C Kit Complete Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS641890 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Recombinant Mycobacterium Smegmatis MSMEG_4149 Protein (aa 1-311)
VAng-Yyj4726-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Smegmatis MSMEG_4149 Protein (aa 1-311)

Sign In for Pricing
View Details