Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3E-CD3G Heterodimer, Mouse (HEK293, Fc)

CD3E protein has predicted functions such as SH3 domain binding and protein heterodimerization, and plays a crucial role in nervous system development and cell adhesion. It is involved in T cell activation, cytokine production and signal transduction. CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc) is a recombinant protein dimer complex containing mouse-derived CD3E-CD3G Heterodimer protein, expressed by HEK293 , with C-hFc labeled tag. CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc), has molecular weight of ~38-40 kDa.

Product Specifications

Product Name Alternative

CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd3e-cd3g-heterodimer-protein-mouse-hek293-fc.html

Purity

95.0

Smiles

DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD&:QTNKAKNLVQVDGSRGDGSVLLTCGLTDKTIKWLKDGSIISPLNATKNTWNLGNNAKDPRGTYQCQGAKETSNPLQVYYRMCENCIELNIGTIS

Molecular Formula

12501&12502 (Gene_ID) NP_031674.1 (D23-D108) &NP_033980.1 (Q23-S116) (Accession)

Molecular Weight

Approximately 38-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACPL2 (PXYLP1) (NM_001282728) Human Tagged ORF Clone
RC238259 10 µg

ACPL2 (PXYLP1) (NM_001282728) Human Tagged ORF Clone

Sign In for Pricing
View Details
Ent-3β-Hydroxykaur-16-en-19-oic acid
HY-N3818 1 Each

Ent-3β-Hydroxykaur-16-en-19-oic acid

Sign In for Pricing
View Details
Mouse Or51h5 qPCR Primer Pair
QM68146S 200 Tests

Mouse Or51h5 qPCR Primer Pair

Sign In for Pricing
View Details
Lentiviral human TTLL4 sgRNA gene knockout kit - Lentiviral human TTLL4 sgRNA gene knockout kit (plasmid)
GTR15361109 1 Vial

Lentiviral human TTLL4 sgRNA gene knockout kit - Lentiviral human TTLL4 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
EAF1 (F-7) : m-IgGκ BP-HRP Bundle
sc-536062 1 Kit

EAF1 (F-7) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
Cat NADH-Ubiquinone Oxidoreductase Chain 2 (MT-ND2) ELISA Kit
MBS9900151 Inquire

Cat NADH-Ubiquinone Oxidoreductase Chain 2 (MT-ND2) ELISA Kit

Sign In for Pricing
View Details