Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3E-CD3G Heterodimer, Mouse (HEK293, Fc)

CD3E protein has predicted functions such as SH3 domain binding and protein heterodimerization, and plays a crucial role in nervous system development and cell adhesion. It is involved in T cell activation, cytokine production and signal transduction. CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc) is a recombinant protein dimer complex containing mouse-derived CD3E-CD3G Heterodimer protein, expressed by HEK293 , with C-hFc labeled tag. CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc), has molecular weight of ~38-40 kDa.

Product Specifications

Product Name Alternative

CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd3e-cd3g-heterodimer-protein-mouse-hek293-fc.html

Purity

95.0

Smiles

DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD&:QTNKAKNLVQVDGSRGDGSVLLTCGLTDKTIKWLKDGSIISPLNATKNTWNLGNNAKDPRGTYQCQGAKETSNPLQVYYRMCENCIELNIGTIS

Molecular Formula

12501&12502 (Gene_ID) NP_031674.1 (D23-D108) &NP_033980.1 (Q23-S116) (Accession)

Molecular Weight

Approximately 38-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Aca f 2
A10U40 1 Each

Recombinant Aca f 2

Sign In for Pricing
View Details
Grainyhead like protein 1 homolog (GRHL1) Rabbit Polyclonal Antibody
TA368452 100 µL

Grainyhead like protein 1 homolog (GRHL1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AdmiRa-Off-hsa-miR-4655-5p Virus
mh6582 1.0 mL

AdmiRa-Off-hsa-miR-4655-5p Virus

Sign In for Pricing
View Details
KCNS2, NT (KCNS2, KIAA1144, Potassium voltage-gated channel subfamily S member 2, Delayed-rectifier K (+) channel alpha subunit 2, Voltage-gated potassium channel subunit Kv9.2) (MaxLight 650) discontinued
037348-ML650 100 µL

KCNS2, NT (KCNS2, KIAA1144, Potassium voltage-gated channel subfamily S member 2, Delayed-rectifier K (+) channel alpha subunit 2, Voltage-gated potassium channel subunit Kv9.2) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal DNA Polymerase epsilon subunit 3 Antibody (PCRP-POLE3-3D3) [Alexa Fluor 350]
NBP3-14143AF350 0.1 mL

Mouse Monoclonal DNA Polymerase epsilon subunit 3 Antibody (PCRP-POLE3-3D3) [Alexa Fluor 350]

Sign In for Pricing
View Details
Rat Dhx34 Pre-designed siRNA Set A
SI203778A 1 Each

Rat Dhx34 Pre-designed siRNA Set A

Sign In for Pricing
View Details