Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3E-CD3G Heterodimer, Mouse (HEK293, Fc)

CD3E protein has predicted functions such as SH3 domain binding and protein heterodimerization, and plays a crucial role in nervous system development and cell adhesion. It is involved in T cell activation, cytokine production and signal transduction. CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc) is a recombinant protein dimer complex containing mouse-derived CD3E-CD3G Heterodimer protein, expressed by HEK293 , with C-hFc labeled tag. CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc), has molecular weight of ~38-40 kDa.

Product Specifications

Product Name Alternative

CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd3e-cd3g-heterodimer-protein-mouse-hek293-fc.html

Purity

95.0

Smiles

DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD&:QTNKAKNLVQVDGSRGDGSVLLTCGLTDKTIKWLKDGSIISPLNATKNTWNLGNNAKDPRGTYQCQGAKETSNPLQVYYRMCENCIELNIGTIS

Molecular Formula

12501&12502 (Gene_ID) NP_031674.1 (D23-D108) &NP_033980.1 (Q23-S116) (Accession)

Molecular Weight

Approximately 38-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

UQCRQ AAV siRNA Pooled Vector
49244161 1.0 µg

UQCRQ AAV siRNA Pooled Vector

Sign In for Pricing
View Details
DNAJC11 Protein Vector (Human) (pPM-C-HA)
PV012755 500 ng

DNAJC11 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Triiodothyronine Free, Human, BioAssayTM ELISA Kit (T3) discontinued
T8425-03 1 Kit

Triiodothyronine Free, Human, BioAssayTM ELISA Kit (T3) discontinued

Sign In for Pricing
View Details
NAALADL2 (Inactive N-acetylated-alpha-linked Acidic Dipeptidase-like Protein 2, NAALADase L2) (HRP)
130112-HRP 100 µL

NAALADL2 (Inactive N-acetylated-alpha-linked Acidic Dipeptidase-like Protein 2, NAALADase L2) (HRP)

Sign In for Pricing
View Details
Nucleostemin (NS) Antibody
abx027775-01 80 µL

Nucleostemin (NS) Antibody

Sign In for Pricing
View Details
Nucleostemin (NS) Antibody
abx027775-02 400 µL

Nucleostemin (NS) Antibody

Sign In for Pricing
View Details