Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3E-CD3G Heterodimer, Mouse (HEK293, Fc)

CD3E protein has predicted functions such as SH3 domain binding and protein heterodimerization, and plays a crucial role in nervous system development and cell adhesion. It is involved in T cell activation, cytokine production and signal transduction. CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc) is a recombinant protein dimer complex containing mouse-derived CD3E-CD3G Heterodimer protein, expressed by HEK293 , with C-hFc labeled tag. CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc), has molecular weight of ~38-40 kDa.

Product Specifications

Product Name Alternative

CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd3e-cd3g-heterodimer-protein-mouse-hek293-fc.html

Purity

95.0

Smiles

DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD&:QTNKAKNLVQVDGSRGDGSVLLTCGLTDKTIKWLKDGSIISPLNATKNTWNLGNNAKDPRGTYQCQGAKETSNPLQVYYRMCENCIELNIGTIS

Molecular Formula

12501&12502 (Gene_ID) NP_031674.1 (D23-D108) &NP_033980.1 (Q23-S116) (Accession)

Molecular Weight

Approximately 38-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vom2r19 (NM_001099492) Rat Tagged Lenti ORF Clone
RR213343L4 10 µg

Vom2r19 (NM_001099492) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Zfp784 AAV siRNA Pooled Vector
51130164 1.0 µg

Zfp784 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Mouse Monoclonal HSP90 alpha Antibody (HSP90AA1/7247) [Biotin]
NBP3-26954B 0.1 mL

Mouse Monoclonal HSP90 alpha Antibody (HSP90AA1/7247) [Biotin]

Sign In for Pricing
View Details
IL36G (Interleukin-36 gamma, IL-1-related Protein 2, IL-1RP2, Interleukin-1 epsilon, IL-1 epsilon, Interleukin-1 Family Member 9, IL-1F9, Interleukin-1 Homolog 1, IL-1H1, IL1E, IL1F9, IL1H1, IL1RP2, UNQ2456/PRO5737)
MBS644737-01 0.1 mg

IL36G (Interleukin-36 gamma, IL-1-related Protein 2, IL-1RP2, Interleukin-1 epsilon, IL-1 epsilon, Interleukin-1 Family Member 9, IL-1F9, Interleukin-1 Homolog 1, IL-1H1, IL1E, IL1F9, IL1H1, IL1RP2, UNQ2456/PRO5737)

Sign In for Pricing
View Details
IL36G (Interleukin-36 gamma, IL-1-related Protein 2, IL-1RP2, Interleukin-1 epsilon, IL-1 epsilon, Interleukin-1 Family Member 9, IL-1F9, Interleukin-1 Homolog 1, IL-1H1, IL1E, IL1F9, IL1H1, IL1RP2, UNQ2456/PRO5737)
MBS644737-02 5x 0.1 mg

IL36G (Interleukin-36 gamma, IL-1-related Protein 2, IL-1RP2, Interleukin-1 epsilon, IL-1 epsilon, Interleukin-1 Family Member 9, IL-1F9, Interleukin-1 Homolog 1, IL-1H1, IL1E, IL1F9, IL1H1, IL1RP2, UNQ2456/PRO5737)

Sign In for Pricing
View Details
Rabbit anti-Enterobacteria phage T4 (Bacteriophage T4) Y06H Polyclonal Antibody
MBS7151727 Inquire

Rabbit anti-Enterobacteria phage T4 (Bacteriophage T4) Y06H Polyclonal Antibody

Sign In for Pricing
View Details