Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3E-CD3G Heterodimer, Mouse (HEK293, Fc)

CD3E protein has predicted functions such as SH3 domain binding and protein heterodimerization, and plays a crucial role in nervous system development and cell adhesion. It is involved in T cell activation, cytokine production and signal transduction. CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc) is a recombinant protein dimer complex containing mouse-derived CD3E-CD3G Heterodimer protein, expressed by HEK293 , with C-hFc labeled tag. CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc), has molecular weight of ~38-40 kDa.

Product Specifications

Product Name Alternative

CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd3e-cd3g-heterodimer-protein-mouse-hek293-fc.html

Purity

95.0

Smiles

DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD&:QTNKAKNLVQVDGSRGDGSVLLTCGLTDKTIKWLKDGSIISPLNATKNTWNLGNNAKDPRGTYQCQGAKETSNPLQVYYRMCENCIELNIGTIS

Molecular Formula

12501&12502 (Gene_ID) NP_031674.1 (D23-D108) &NP_033980.1 (Q23-S116) (Accession)

Molecular Weight

Approximately 38-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

pLVX-Puro-Tid1-L Plasmid
PVTB00190-2b 2 µg

pLVX-Puro-Tid1-L Plasmid

Sign In for Pricing
View Details
Glucokinase (GCK) (NM_033507) Human Over-expression Lysate
LC409539 20 µg

Glucokinase (GCK) (NM_033507) Human Over-expression Lysate

Sign In for Pricing
View Details
SLC15A2 Protein Vector (Human) (pPB-N-His)
PV129427 500 ng

SLC15A2 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Canada balsam
GT1682-500ml 500 mL

Canada balsam

Sign In for Pricing
View Details
Noggin (Synostoses (Multiple) Syndrome 1, SYNS 1, NOG, SYNS1, SYM1, Symphalangism 1 (Proximal), SYM 1) (FITC)
301424-FITC 100 µL

Noggin (Synostoses (Multiple) Syndrome 1, SYNS 1, NOG, SYNS1, SYM1, Symphalangism 1 (Proximal), SYM 1) (FITC)

Sign In for Pricing
View Details
NF-kappaB p100, phosphorylated (Ser872)
525945-01 100 µL

NF-kappaB p100, phosphorylated (Ser872)

Sign In for Pricing
View Details