Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3E-CD3G Heterodimer, Mouse (HEK293, Fc)

CD3E protein has predicted functions such as SH3 domain binding and protein heterodimerization, and plays a crucial role in nervous system development and cell adhesion. It is involved in T cell activation, cytokine production and signal transduction. CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc) is a recombinant protein dimer complex containing mouse-derived CD3E-CD3G Heterodimer protein, expressed by HEK293 , with C-hFc labeled tag. CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc), has molecular weight of ~38-40 kDa.

Product Specifications

Product Name Alternative

CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd3e-cd3g-heterodimer-protein-mouse-hek293-fc.html

Purity

95.0

Smiles

DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD&:QTNKAKNLVQVDGSRGDGSVLLTCGLTDKTIKWLKDGSIISPLNATKNTWNLGNNAKDPRGTYQCQGAKETSNPLQVYYRMCENCIELNIGTIS

Molecular Formula

12501&12502 (Gene_ID) NP_031674.1 (D23-D108) &NP_033980.1 (Q23-S116) (Accession)

Molecular Weight

Approximately 38-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Copper (II) Sulphate Anhydrous 98% Extrapure
00875 00500 500 g

Copper (II) Sulphate Anhydrous 98% Extrapure

Sign In for Pricing
View Details
Zc3h18 ORF Vector (Mouse) (pORF)
ORF062116 1.0 µg DNA

Zc3h18 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
MEX3B sgRNA CRISPR Lentivector (Human) (Target 3)
K1295004 1.0 µg DNA

MEX3B sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
PLV3-U6-CD40-shRNA3-CopGFP-Puro Plasmid
PVT76299 2 µg

PLV3-U6-CD40-shRNA3-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
Tenascin C (TNC) Antibody
abx100415 100 µg

Tenascin C (TNC) Antibody

Sign In for Pricing
View Details
Monkey Calcium-responsive transactivator (SS18L1) ELISA Kit
MBS7210729-01 48 Well

Monkey Calcium-responsive transactivator (SS18L1) ELISA Kit

Sign In for Pricing
View Details