Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3E-CD3G Heterodimer, Mouse (HEK293, Fc)

CD3E protein has predicted functions such as SH3 domain binding and protein heterodimerization, and plays a crucial role in nervous system development and cell adhesion. It is involved in T cell activation, cytokine production and signal transduction. CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc) is a recombinant protein dimer complex containing mouse-derived CD3E-CD3G Heterodimer protein, expressed by HEK293 , with C-hFc labeled tag. CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc), has molecular weight of ~38-40 kDa.

Product Specifications

Product Name Alternative

CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd3e-cd3g-heterodimer-protein-mouse-hek293-fc.html

Purity

95.0

Smiles

DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD&:QTNKAKNLVQVDGSRGDGSVLLTCGLTDKTIKWLKDGSIISPLNATKNTWNLGNNAKDPRGTYQCQGAKETSNPLQVYYRMCENCIELNIGTIS

Molecular Formula

12501&12502 (Gene_ID) NP_031674.1 (D23-D108) &NP_033980.1 (Q23-S116) (Accession)

Molecular Weight

Approximately 38-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human ZDHHC21 polyclonal antibody
CABT-ZB119 100 μg

Rabbit Anti-Human ZDHHC21 polyclonal antibody

Sign In for Pricing
View Details
Brd4 (NM_020508) Mouse Tagged Lenti ORF Clone
MR224909L4 10 µg

Brd4 (NM_020508) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rgs1 Mouse siRNA Oligo Duplex (Locus ID 50778)
SR404956 1 Kit

Rgs1 Mouse siRNA Oligo Duplex (Locus ID 50778)

Sign In for Pricing
View Details
Anti-Mob1A Rabbit pAb
GB114314-50 50 μL

Anti-Mob1A Rabbit pAb

Sign In for Pricing
View Details
ALDH1L1 Protein Vector (Human) (pPM-N-D-C-HA)
PV321152 500 ng

ALDH1L1 Protein Vector (Human) (pPM-N-D-C-HA)

Sign In for Pricing
View Details
Human Suppressor of IKBKE 1 (SIKE1) ELISA Kit
abx383203 96 Tests

Human Suppressor of IKBKE 1 (SIKE1) ELISA Kit

Sign In for Pricing
View Details