Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3E-CD3G Heterodimer, Mouse (HEK293, Fc)

CD3E protein has predicted functions such as SH3 domain binding and protein heterodimerization, and plays a crucial role in nervous system development and cell adhesion. It is involved in T cell activation, cytokine production and signal transduction. CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc) is a recombinant protein dimer complex containing mouse-derived CD3E-CD3G Heterodimer protein, expressed by HEK293 , with C-hFc labeled tag. CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc), has molecular weight of ~38-40 kDa.

Product Specifications

Product Name Alternative

CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd3e-cd3g-heterodimer-protein-mouse-hek293-fc.html

Purity

95.0

Smiles

DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD&:QTNKAKNLVQVDGSRGDGSVLLTCGLTDKTIKWLKDGSIISPLNATKNTWNLGNNAKDPRGTYQCQGAKETSNPLQVYYRMCENCIELNIGTIS

Molecular Formula

12501&12502 (Gene_ID) NP_031674.1 (D23-D108) &NP_033980.1 (Q23-S116) (Accession)

Molecular Weight

Approximately 38-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Box of 100 Pc Membranes 0.45 µm, 47 Mm
MF047PC045C Box of 100

Box of 100 Pc Membranes 0.45 µm, 47 Mm

Sign In for Pricing
View Details
PSME1 Protein (N-His, Human)
P527880 100 µg

PSME1 Protein (N-His, Human)

Sign In for Pricing
View Details
CCT6B sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0397405 3x 1.0 µg

CCT6B sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
YY2 Recombinant Protein (Mouse)
RP186128 100 µg

YY2 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Fmoc-D-4-Bromophe
MBS9023481-01 1 g

Fmoc-D-4-Bromophe

Sign In for Pricing
View Details
Fmoc-D-4-Bromophe
MBS9023481-02 5x 1 g

Fmoc-D-4-Bromophe

Sign In for Pricing
View Details