Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-17RD, Canine (HEK293, His)

Interleukin-17 receptor D (IL-17RD) also known as Sef (similar expression to fibroblast growth factor), is a type I transmembrane protein that can regulate several signaling pathways. Within the cell, IL-17RD expression has been localized mainly to the plasma membrane. IL-17RD is a feedback inhibitor of fibroblast growth factor (FGF) signaling[1]. IL-17RD Protein, Canine (HEK293, His) is produced in HEK293 cells with a His-Terminal Fc-tag.

Product Specifications

Product Name Alternative

IL-17RD Protein, Canine (HEK293, His), Canine, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-17rd-protein-canine-hek293-his.html

Purity

98.0

Smiles

AGGSSRARGADTCGWRGVGPASRNSGLYNITFRYDNCTTYLNPVGKHVIADAQNITISQYACHDQVAVTILWSPGALGIEFLKGFRVILEELKSEGRRCQQLILKDPKQLNSSFKRTGMESQPFLNMKFETDYFVKIVPFPSIKNESNYHPFFFRTRACDLLLQPDNLACKPFWKPRNLNITQHGLDMQVSFDHAPHTFGFRFFYLHYKLKHEGPFKRKACKQEQNTETTSCLLQNVSPGDYIIELVDDTNTTRKVMHYALKPAHSPWAGPIR

Molecular Formula

484719 (Gene_ID) A0A8C0JXH0/XP_541835 (A27-R299) (Accession)

Molecular Weight

Approximately 43-60 kDa due to the glycosylation

References & Citations

[1]Shivangi Pande, et al. Interleukin-17 receptor D (Sef) is a multi-functional regulator of cell signaling. Cell Commun Signal. 2021 Jan 12;19 (1) :6.|[2]Mark Mellett, et al. Orphan receptor IL-17RD regulates Toll-like receptor signalling via SEFIR/TIR interactions. Nat Commun. 2015 Mar 26;6:6669.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF488A conjugate, 0.1mg/mL
BNC880152-100 1x 100 µL

CD11c (HC1/1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF594 conjugate, 0.1mg/mL
BNC940333-500 1x 500 µL

CD8 (RIV11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL
BNC470391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL
BNC740676-100 1x 100 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405S conjugate, 0.1mg/mL
BNC041429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Progesterone Receptor (PR500), CF488A conjugate, 0.1mg/mL
BNC880500-500 1x 500 µL

Progesterone Receptor (PR500), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details