Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein-lysine 6-oxidase (LOX), partial

Product Specifications

Product Name Alternative

Lysyl oxidase

Abbreviation

Recombinant Human LOX protein, partial

Gene Name

LOX

UniProt

P28300

Expression Region

174-417aa

Organism

Homo sapiens (Human)

Target Sequence

PYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin. Regulator of Ras expression. May play a role in tumor suppression. Plays a role in the aortic wall architecture.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

35.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

V1RA5 shRNA Plasmid (m)
sc-154970-SH 20 µg

V1RA5 shRNA Plasmid (m)

Sign In for Pricing
View Details
Ccdc30 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4893003 1.0 µg DNA

Ccdc30 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
STAT1 (Signal Transducer and Activator of Transcription 1-alpha/beta, Transcription Factor ISGF-3 Components p91/p84, DKFZp686B04100) (Biotin)
MBS6144621-01 0.1 mL

STAT1 (Signal Transducer and Activator of Transcription 1-alpha/beta, Transcription Factor ISGF-3 Components p91/p84, DKFZp686B04100) (Biotin)

Sign In for Pricing
View Details
STAT1 (Signal Transducer and Activator of Transcription 1-alpha/beta, Transcription Factor ISGF-3 Components p91/p84, DKFZp686B04100) (Biotin)
MBS6144621-02 5x 0.1 mL

STAT1 (Signal Transducer and Activator of Transcription 1-alpha/beta, Transcription Factor ISGF-3 Components p91/p84, DKFZp686B04100) (Biotin)

Sign In for Pricing
View Details
PCMV-6xHis-CDH4-Neo Plasmid
PVT72813 2 µg

PCMV-6xHis-CDH4-Neo Plasmid

Sign In for Pricing
View Details
237 equivalent to Grade 3
2370-4657-100S 1 unit

237 equivalent to Grade 3

Sign In for Pricing
View Details