Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFN-alpha 2/IFNA2, Mouse (His)

IFN-alpha 2/IFNA2 Protein, synthesized by macrophages, exhibits potent antiviral activities. Its interaction with IFNAR2 plays a pivotal role in signaling processes, contributing to the intricate network of antiviral defense mechanisms. IFN-alpha 2/IFNA2 Protein, Mouse (His) is the recombinant mouse-derived IFN-alpha 2/IFNA2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IFN-alpha 2/IFNA2 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-alpha-2-ifna2-protein-mouse-his.html

Purity

95.50

Smiles

CDLPHTYNLRNKRALKVLAQMRRLPFLSCLKDRQDFGFPLEKVDNQQIQKAQAIPVLRDLTQQTLNLFTSKASSAAWNATLLDSFCNDLHQQLNDLQTCLMQQVGVQEPPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSVNLLPRLSEEKE

Molecular Formula

15965 (Gene_ID) P01573 (C24-E190) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF647 conjugate, 0.1mg/mL
BNC470158-100 1x 100 µL

Cytokeratin 17 (E3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF405S conjugate, 0.1mg/mL
BNC040633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL
BNC680965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF647 conjugate, 0.1mg/mL
BNC471003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF740 conjugate, 0.1mg/mL
BNC740253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (rVEGI/1283), CF568 conjugate, 0.1mg/mL
BNC682059-100 1x 100 µL

TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (rVEGI/1283), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details