Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGS5, Human (His)

RGS5, an adept signal transduction modulator, enhances G protein alpha subunit GTPase activity, promoting their transition to the inactive GDP-bound state. Interacting with G (i) -alpha and G (o) -alpha, it selectively excludes G (s) -alpha, highlighting its precise role in regulating specific G protein subunits and fine-tuning cellular signaling pathways. RGS5 Protein, Human (His) is the recombinant human-derived RGS5 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

RGS5 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rgs5-protein-human-his.html

Purity

90.00

Smiles

MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK

Molecular Formula

8490 (Gene_ID) O15539 (M1-K181) (Accession)

Molecular Weight

Approximately 25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Phosphate Buffered Saline powder (PBS) pH 7.4, 50 l
12-9425-1 1 Pouch

Phosphate Buffered Saline powder (PBS) pH 7.4, 50 l

Ask
View Details
RETN Peptide
DF8288-BP 1 mg

RETN Peptide

Ask
View Details
HIF-1 beta Antibody
MBS9435709-01 0.05 mL

HIF-1 beta Antibody

Ask
View Details
HIF-1 beta Antibody
MBS9435709-02 0.1 mL

HIF-1 beta Antibody

Ask
View Details
HIF-1 beta Antibody
MBS9435709-03 5x 0.1 mL

HIF-1 beta Antibody

Ask
View Details
YBX1 (NSEP1, YB1, Nuclease-sensitive Element-binding Protein 1, CCAAT-binding Transcription Factor I Subunit A, DNA-binding Protein B, Enhancer Factor I Subunit A, Y-box Transcription Factor, Y-box-binding Protein 1, MGC104858, MGC110976, MGC117250) (MaxL
MBS6214803-01 0.1 mL

YBX1 (NSEP1, YB1, Nuclease-sensitive Element-binding Protein 1, CCAAT-binding Transcription Factor I Subunit A, DNA-binding Protein B, Enhancer Factor I Subunit A, Y-box Transcription Factor, Y-box-binding Protein 1, MGC104858, MGC110976, MGC117250) (MaxL

Ask
View Details