Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGS5, Human (His)

RGS5, an adept signal transduction modulator, enhances G protein alpha subunit GTPase activity, promoting their transition to the inactive GDP-bound state. Interacting with G (i) -alpha and G (o) -alpha, it selectively excludes G (s) -alpha, highlighting its precise role in regulating specific G protein subunits and fine-tuning cellular signaling pathways. RGS5 Protein, Human (His) is the recombinant human-derived RGS5 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

RGS5 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rgs5-protein-human-his.html

Purity

90.00

Smiles

MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK

Molecular Formula

8490 (Gene_ID) O15539 (M1-K181) (Accession)

Molecular Weight

Approximately 25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FLJ45966 Human shRNA Lentiviral Particle (Locus ID 401120)
TL319598V 500 µL Each

FLJ45966 Human shRNA Lentiviral Particle (Locus ID 401120)

Sign In for Pricing
View Details
LymphoPrep™ Tubes 18 x 10 mL
18001 1 Unit

LymphoPrep™ Tubes 18 x 10 mL

Sign In for Pricing
View Details
C18orf32 (NM_001035005) Human Recombinant Protein
TP310558L 1 mg

C18orf32 (NM_001035005) Human Recombinant Protein

Sign In for Pricing
View Details
CCR3 Protein Vector (Rat) (pPM-C-His)
PV258381 500 ng

CCR3 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
ADAM12 Immunizing Peptide
MBS428021-01 0.1 mg

ADAM12 Immunizing Peptide

Sign In for Pricing
View Details
ADAM12 Immunizing Peptide
MBS428021-02 5x 0.1 mg

ADAM12 Immunizing Peptide

Sign In for Pricing
View Details