Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGS5, Human (His)

RGS5, an adept signal transduction modulator, enhances G protein alpha subunit GTPase activity, promoting their transition to the inactive GDP-bound state. Interacting with G (i) -alpha and G (o) -alpha, it selectively excludes G (s) -alpha, highlighting its precise role in regulating specific G protein subunits and fine-tuning cellular signaling pathways. RGS5 Protein, Human (His) is the recombinant human-derived RGS5 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

RGS5 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rgs5-protein-human-his.html

Purity

90.00

Smiles

MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK

Molecular Formula

8490 (Gene_ID) O15539 (M1-K181) (Accession)

Molecular Weight

Approximately 25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Arginase 2, ARG2 ELISA Kit
MBS1605922-01 48 Well

Human Arginase 2, ARG2 ELISA Kit

Sign In for Pricing
View Details
Human Arginase 2, ARG2 ELISA Kit
MBS1605922-02 96 Well

Human Arginase 2, ARG2 ELISA Kit

Sign In for Pricing
View Details
Human Arginase 2, ARG2 ELISA Kit
MBS1605922-03 5x 96 Well

Human Arginase 2, ARG2 ELISA Kit

Sign In for Pricing
View Details
Human Arginase 2, ARG2 ELISA Kit
MBS1605922-04 10x 96 Well

Human Arginase 2, ARG2 ELISA Kit

Sign In for Pricing
View Details
Recombinant Human IFI30 Protein, His, E.coli-1mg
QP12372-1mg 1mg

Recombinant Human IFI30 Protein, His, E.coli-1mg

Sign In for Pricing
View Details
Rnf25 Mouse qPCR Primer Pair (NM_021313)
MP214806 200 Reactions

Rnf25 Mouse qPCR Primer Pair (NM_021313)

Sign In for Pricing
View Details