Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGS5, Human (His)

RGS5, an adept signal transduction modulator, enhances G protein alpha subunit GTPase activity, promoting their transition to the inactive GDP-bound state. Interacting with G (i) -alpha and G (o) -alpha, it selectively excludes G (s) -alpha, highlighting its precise role in regulating specific G protein subunits and fine-tuning cellular signaling pathways. RGS5 Protein, Human (His) is the recombinant human-derived RGS5 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

RGS5 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rgs5-protein-human-his.html

Purity

90.00

Smiles

MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK

Molecular Formula

8490 (Gene_ID) O15539 (M1-K181) (Accession)

Molecular Weight

Approximately 25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Donkey Anti-Rabbit IgG H&L Antibody (ALP)
abx239392-01 100 µL

Donkey Anti-Rabbit IgG H&L Antibody (ALP)

Sign In for Pricing
View Details
Donkey Anti-Rabbit IgG H&L Antibody (ALP)
abx239392-02 500 µL

Donkey Anti-Rabbit IgG H&L Antibody (ALP)

Sign In for Pricing
View Details
Vacutainer Eclipse needles 21 X 1.25
368650 100 / PCK

Vacutainer Eclipse needles 21 X 1.25

Sign In for Pricing
View Details
Rabbit Polyclonal IL-1 beta/IL-1F2 Antibody [Alexa Fluor 700]
NBP1-19775AF700 0.1 mL

Rabbit Polyclonal IL-1 beta/IL-1F2 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Recombinant Human MANF Protein, N-His
YHF10001 100 μg

Recombinant Human MANF Protein, N-His

Sign In for Pricing
View Details
PIK3R2 3'UTR Luciferase Stable Cell Line
TU017966 1.0 mL

PIK3R2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details