Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGS5, Human (His)

RGS5, an adept signal transduction modulator, enhances G protein alpha subunit GTPase activity, promoting their transition to the inactive GDP-bound state. Interacting with G (i) -alpha and G (o) -alpha, it selectively excludes G (s) -alpha, highlighting its precise role in regulating specific G protein subunits and fine-tuning cellular signaling pathways. RGS5 Protein, Human (His) is the recombinant human-derived RGS5 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

RGS5 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rgs5-protein-human-his.html

Purity

90.00

Smiles

MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK

Molecular Formula

8490 (Gene_ID) O15539 (M1-K181) (Accession)

Molecular Weight

Approximately 25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD46 Antibody (122.2) [Alexa Fluor 488]
NBP2-33159AF488 0.1 mL

Mouse Monoclonal CD46 Antibody (122.2) [Alexa Fluor 488]

Sign In for Pricing
View Details
Derl1 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6438404 1.0 µg DNA

Derl1 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Petroleum Ether 100-120°C
GS5534-2500ml 2500 mL

Petroleum Ether 100-120°C

Sign In for Pricing
View Details
VAMP5 Antibody, Biotin conjugated
A38226-50UG 50 µg

VAMP5 Antibody, Biotin conjugated

Sign In for Pricing
View Details
ARL6IP6 (ADP-ribosylation Factor-like Protein 6-interacting Protein 6, Phosphonoformate Immuno-associated Protein 1, AIP-6, PFAAP1) (MaxLight 650)
MBS6407243-01 0.1 mL

ARL6IP6 (ADP-ribosylation Factor-like Protein 6-interacting Protein 6, Phosphonoformate Immuno-associated Protein 1, AIP-6, PFAAP1) (MaxLight 650)

Sign In for Pricing
View Details
ARL6IP6 (ADP-ribosylation Factor-like Protein 6-interacting Protein 6, Phosphonoformate Immuno-associated Protein 1, AIP-6, PFAAP1) (MaxLight 650)
MBS6407243-02 5x 0.1 mL

ARL6IP6 (ADP-ribosylation Factor-like Protein 6-interacting Protein 6, Phosphonoformate Immuno-associated Protein 1, AIP-6, PFAAP1) (MaxLight 650)

Sign In for Pricing
View Details