Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGS5, Human (His)

RGS5, an adept signal transduction modulator, enhances G protein alpha subunit GTPase activity, promoting their transition to the inactive GDP-bound state. Interacting with G (i) -alpha and G (o) -alpha, it selectively excludes G (s) -alpha, highlighting its precise role in regulating specific G protein subunits and fine-tuning cellular signaling pathways. RGS5 Protein, Human (His) is the recombinant human-derived RGS5 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

RGS5 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rgs5-protein-human-his.html

Purity

90.00

Smiles

MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK

Molecular Formula

8490 (Gene_ID) O15539 (M1-K181) (Accession)

Molecular Weight

Approximately 25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CACNB3, CT (Voltage-dependent L-type Calcium Channel Subunit beta-3, CAB3, Calcium Channel Voltage-dependent Subunit beta 3, CACNLB3) (MaxLight 550) discontinued
033132-ML550 100 µL

CACNB3, CT (Voltage-dependent L-type Calcium Channel Subunit beta-3, CAB3, Calcium Channel Voltage-dependent Subunit beta 3, CACNLB3) (MaxLight 550) discontinued

Ask
View Details
LGALS7B siRNA (Human)
CRJ8580-01 15 nmol

LGALS7B siRNA (Human)

Ask
View Details
LGALS7B siRNA (Human)
CRJ8580-02 30 nmol

LGALS7B siRNA (Human)

Ask
View Details
Recombinant Mouse Myb-related transcription factor, partner of profilin (Mypop)
MBS1329612-01 0.02 mg (E-Coli)

Recombinant Mouse Myb-related transcription factor, partner of profilin (Mypop)

Ask
View Details
Recombinant Mouse Myb-related transcription factor, partner of profilin (Mypop)
MBS1329612-02 0.02 mg (Yeast)

Recombinant Mouse Myb-related transcription factor, partner of profilin (Mypop)

Ask
View Details
Recombinant Mouse Myb-related transcription factor, partner of profilin (Mypop)
MBS1329612-03 0.1 mg (E-Coli)

Recombinant Mouse Myb-related transcription factor, partner of profilin (Mypop)

Ask
View Details