Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGS5, Human (His)

RGS5, an adept signal transduction modulator, enhances G protein alpha subunit GTPase activity, promoting their transition to the inactive GDP-bound state. Interacting with G (i) -alpha and G (o) -alpha, it selectively excludes G (s) -alpha, highlighting its precise role in regulating specific G protein subunits and fine-tuning cellular signaling pathways. RGS5 Protein, Human (His) is the recombinant human-derived RGS5 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

RGS5 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rgs5-protein-human-his.html

Purity

90.00

Smiles

MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK

Molecular Formula

8490 (Gene_ID) O15539 (M1-K181) (Accession)

Molecular Weight

Approximately 25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

BRMS1L (NM_032352) Human Tagged ORF Clone
RG202645 10 µg

BRMS1L (NM_032352) Human Tagged ORF Clone

Ask
View Details
USP50 siRNA Oligos set (Human)
49336171 3x 5 nmol

USP50 siRNA Oligos set (Human)

Ask
View Details
PHF7 (PHD Finger Protein 7, Testis Development Protein NYD-SP6, DKFZp434L1850, HSPC045, HSPC226, MGC26088, NYD-SP6) (AP)
MBS6132914-01 0.1 mL

PHF7 (PHD Finger Protein 7, Testis Development Protein NYD-SP6, DKFZp434L1850, HSPC045, HSPC226, MGC26088, NYD-SP6) (AP)

Ask
View Details
PHF7 (PHD Finger Protein 7, Testis Development Protein NYD-SP6, DKFZp434L1850, HSPC045, HSPC226, MGC26088, NYD-SP6) (AP)
MBS6132914-02 5x 0.1 mL

PHF7 (PHD Finger Protein 7, Testis Development Protein NYD-SP6, DKFZp434L1850, HSPC045, HSPC226, MGC26088, NYD-SP6) (AP)

Ask
View Details
Canine Cluster of Differentiation 86 ELISA Kit
MBS744635-01 48 Well

Canine Cluster of Differentiation 86 ELISA Kit

Ask
View Details
Canine Cluster of Differentiation 86 ELISA Kit
MBS744635-02 96 Well

Canine Cluster of Differentiation 86 ELISA Kit

Ask
View Details