Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGS5, Human (His)

RGS5, an adept signal transduction modulator, enhances G protein alpha subunit GTPase activity, promoting their transition to the inactive GDP-bound state. Interacting with G (i) -alpha and G (o) -alpha, it selectively excludes G (s) -alpha, highlighting its precise role in regulating specific G protein subunits and fine-tuning cellular signaling pathways. RGS5 Protein, Human (His) is the recombinant human-derived RGS5 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

RGS5 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rgs5-protein-human-his.html

Purity

90.00

Smiles

MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK

Molecular Formula

8490 (Gene_ID) O15539 (M1-K181) (Accession)

Molecular Weight

Approximately 25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral mouse Pou1f1 shRNA (UAS) - Lentiviral mouse Pou1f1 shRNA (UAS, RFP) plasmid
GTR15186445 1 Vial

Lentiviral mouse Pou1f1 shRNA (UAS) - Lentiviral mouse Pou1f1 shRNA (UAS, RFP) plasmid

Ask
View Details
Hars2 Mouse shRNA Plasmid (Locus ID 70791)
TL516900 1 Kit

Hars2 Mouse shRNA Plasmid (Locus ID 70791)

Ask
View Details
SA2 (STAG2) Rabbit Polyclonal Antibody
TA385325 100 µL

SA2 (STAG2) Rabbit Polyclonal Antibody

Ask
View Details
Lentiviral human CD81 shRNA (UAS) - Lentiviral human CD81 shRNA (UAS, GFP) plasmid
GTR15320509 1 Vial

Lentiviral human CD81 shRNA (UAS) - Lentiviral human CD81 shRNA (UAS, GFP) plasmid

Ask
View Details
INPP5B, CT (INPP5B, OCRL2, Type II inositol 1,4,5-trisphosphate 5-phosphatase, 75kD inositol polyphosphate-5-phosphatase, Phosphoinositide 5-phosphatase) (PE)
MBS6310596-01 0.2 mL

INPP5B, CT (INPP5B, OCRL2, Type II inositol 1,4,5-trisphosphate 5-phosphatase, 75kD inositol polyphosphate-5-phosphatase, Phosphoinositide 5-phosphatase) (PE)

Ask
View Details
INPP5B, CT (INPP5B, OCRL2, Type II inositol 1,4,5-trisphosphate 5-phosphatase, 75kD inositol polyphosphate-5-phosphatase, Phosphoinositide 5-phosphatase) (PE)
MBS6310596-02 5x 0.2 mL

INPP5B, CT (INPP5B, OCRL2, Type II inositol 1,4,5-trisphosphate 5-phosphatase, 75kD inositol polyphosphate-5-phosphatase, Phosphoinositide 5-phosphatase) (PE)

Ask
View Details