Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Brain acid soluble protein 1 (Basp1)

Product Specifications

Product Name Alternative

22 kDa neuronal tissue-enriched acidic protein; Neuronal axonal membrane protein NAP-22

Abbreviation

Recombinant Mouse Basp1 protein

Gene Name

Basp1

UniProt

Q91XV3

Expression Region

2-226aa

Organism

Mus musculus (Mouse)

Target Sequence

GGKLSKKKKGYNVNDEKAKDKDKKAEGAGTEEEGTPKESEPQAAADATEVKESTEEKPKDAADGEAKAEEKEADKAAAAKEEAPKAEPEKSEGAAEEQPEPAPAPEQEAAAPGPAAGGEAPKAGEASAESTGAADGAAPEEGEAKKTEAPAAAGPEAKSDAAPAASDSKPSSAEPAPSSKETPAASEAPSSAAKAPAPAAPAAAEPQAEAPAAAASSEQSVAVKE

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

28.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAX (NM_145112) Human Recombinant Protein
TP306812L 1 mg

MAX (NM_145112) Human Recombinant Protein

Sign In for Pricing
View Details
Human HSF1 activation kit by CRISPRa
GA102251 1 Kit

Human HSF1 activation kit by CRISPRa

Sign In for Pricing
View Details
SLC15A1 Rabbit Polyclonal Antibody
TA372279 100 µL

SLC15A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MEIS2 Human Gene Knockout Kit (CRISPR)
KN401395 1 Kit

MEIS2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Mouse CD83/HB15 Protein (aa 1-133, Fc Tag)
PKSM040542 100 µg

Recombinant Mouse CD83/HB15 Protein (aa 1-133, Fc Tag)

Sign In for Pricing
View Details
Isoamyl Alcohol
TRC-I780010-10G 10 g

Isoamyl Alcohol

Sign In for Pricing
View Details