Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Brain acid soluble protein 1 (Basp1)

Product Specifications

Product Name Alternative

22 kDa neuronal tissue-enriched acidic protein; Neuronal axonal membrane protein NAP-22

Abbreviation

Recombinant Mouse Basp1 protein

Gene Name

Basp1

UniProt

Q91XV3

Expression Region

2-226aa

Organism

Mus musculus (Mouse)

Target Sequence

GGKLSKKKKGYNVNDEKAKDKDKKAEGAGTEEEGTPKESEPQAAADATEVKESTEEKPKDAADGEAKAEEKEADKAAAAKEEAPKAEPEKSEGAAEEQPEPAPAPEQEAAAPGPAAGGEAPKAGEASAESTGAADGAAPEEGEAKKTEAPAAAGPEAKSDAAPAASDSKPSSAEPAPSSKETPAASEAPSSAAKAPAPAAPAAAEPQAEAPAAAASSEQSVAVKE

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

28.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cyp7a1 activation kit by CRISPRa
GA201003 1 Kit

Mouse Cyp7a1 activation kit by CRISPRa

Sign In for Pricing
View Details
S6K1 (RPS6KB1) pThr444 Rabbit Polyclonal Antibody
AP20853PU-N 100 µg

S6K1 (RPS6KB1) pThr444 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Weighing Scale BBAL-419
BBAL-419 1 Unit

Weighing Scale BBAL-419

Sign In for Pricing
View Details
Granulocyte-Colony Stimulating Factor (G-CSF) (CSF3) (CSF3/900), Biotin conjugate, 0.1mg/mL
BNCB0900-100 1x 100 µL

Granulocyte-Colony Stimulating Factor (G-CSF) (CSF3) (CSF3/900), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/2576), CF488A conjugate, 0.1mg/mL
BNC882576-100 1x 100 µL

NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/2576), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RFC2 (N-term) Rabbit Polyclonal Antibody
AP12446PU-N 400 µL

RFC2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details