Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ephrin-A3/EFNA3, Human (HEK293, solution)

Ephrin-A3/EFNA3 proteins are cell surface GPI-binding ligands of Eph receptors and play a key role in regulating key cellular processes such as migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. As a promiscuous binder, Ephrin-A3 binds to Eph receptors on neighboring cells, initiating contact-dependent bidirectional signaling to neighboring cells. Ephrin-A3/EFNA3 Protein, Human (HEK293, solution) is the recombinant human-derived Ephrin-A3/EFNA3 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

Ephrin-A3/EFNA3 Protein, Human (HEK293, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ephrin-a3-efna3-protein-human-hek293.html

Purity

95.60

Smiles

QGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSIS

Molecular Formula

1944 (Gene_ID) P52797-1/NP_004943.1 (Q23-S213) (Accession)

Molecular Weight

35-40 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MBTPS2 (S2P, Membrane-bound Transcription Factor Site-2 Protease, Endopeptidase S2P, Sterol Regulatory Element-binding Proteins Intramembrane Protease, FLJ32174) (HRP)
MBS6153460-01 0.1 mL

MBTPS2 (S2P, Membrane-bound Transcription Factor Site-2 Protease, Endopeptidase S2P, Sterol Regulatory Element-binding Proteins Intramembrane Protease, FLJ32174) (HRP)

Ask
View Details
MBTPS2 (S2P, Membrane-bound Transcription Factor Site-2 Protease, Endopeptidase S2P, Sterol Regulatory Element-binding Proteins Intramembrane Protease, FLJ32174) (HRP)
MBS6153460-02 5x 0.1 mL

MBTPS2 (S2P, Membrane-bound Transcription Factor Site-2 Protease, Endopeptidase S2P, Sterol Regulatory Element-binding Proteins Intramembrane Protease, FLJ32174) (HRP)

Ask
View Details
C2cd5 (NM_001134581) Rat Untagged Clone
RN205496 10 µg

C2cd5 (NM_001134581) Rat Untagged Clone

Ask
View Details
Rabbit Monoclonal IGF-II/IGF2 Antibody (110) [PerCP]
NBP2-90372PCP 0.1 mL

Rabbit Monoclonal IGF-II/IGF2 Antibody (110) [PerCP]

Ask
View Details
IL22 (Interleukin-22, IL-22, Cytokine Zcyto18, IL-10-related T-cell-derived-inducible Factor, IL-TIF, ILTIF, ZCYTO18, UNQ3099/PRO10096, MGC79382, MGC79384) (PE)
MBS6403741-01 0.1 mL

IL22 (Interleukin-22, IL-22, Cytokine Zcyto18, IL-10-related T-cell-derived-inducible Factor, IL-TIF, ILTIF, ZCYTO18, UNQ3099/PRO10096, MGC79382, MGC79384) (PE)

Ask
View Details
IL22 (Interleukin-22, IL-22, Cytokine Zcyto18, IL-10-related T-cell-derived-inducible Factor, IL-TIF, ILTIF, ZCYTO18, UNQ3099/PRO10096, MGC79382, MGC79384) (PE)
MBS6403741-02 5x 0.1 mL

IL22 (Interleukin-22, IL-22, Cytokine Zcyto18, IL-10-related T-cell-derived-inducible Factor, IL-TIF, ILTIF, ZCYTO18, UNQ3099/PRO10096, MGC79382, MGC79384) (PE)

Ask
View Details