Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ephrin-A3/EFNA3, Human (HEK293, solution)

Ephrin-A3/EFNA3 proteins are cell surface GPI-binding ligands of Eph receptors and play a key role in regulating key cellular processes such as migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. As a promiscuous binder, Ephrin-A3 binds to Eph receptors on neighboring cells, initiating contact-dependent bidirectional signaling to neighboring cells. Ephrin-A3/EFNA3 Protein, Human (HEK293, solution) is the recombinant human-derived Ephrin-A3/EFNA3 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

Ephrin-A3/EFNA3 Protein, Human (HEK293, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ephrin-a3-efna3-protein-human-hek293.html

Purity

95.60

Smiles

QGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSIS

Molecular Formula

1944 (Gene_ID) P52797-1/NP_004943.1 (Q23-S213) (Accession)

Molecular Weight

35-40 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal CHREBP Antibody (2D9NB) [mFluor Violet 450 SE]
NBP2-44307MFV450 0.1 mL

Mouse Monoclonal CHREBP Antibody (2D9NB) [mFluor Violet 450 SE]

Ask
View Details
IKK beta (IKBKB, IKKB, Inhibitor of nuclear factor kappa-B kinase subunit beta, I-kappa-B kinase 2, Nuclear factor NF-kappa-B inhibitor kinase beta) (MaxLight 550)
MBS6209937-01 0.1 mL

IKK beta (IKBKB, IKKB, Inhibitor of nuclear factor kappa-B kinase subunit beta, I-kappa-B kinase 2, Nuclear factor NF-kappa-B inhibitor kinase beta) (MaxLight 550)

Ask
View Details
IKK beta (IKBKB, IKKB, Inhibitor of nuclear factor kappa-B kinase subunit beta, I-kappa-B kinase 2, Nuclear factor NF-kappa-B inhibitor kinase beta) (MaxLight 550)
MBS6209937-02 5x 0.1 mL

IKK beta (IKBKB, IKKB, Inhibitor of nuclear factor kappa-B kinase subunit beta, I-kappa-B kinase 2, Nuclear factor NF-kappa-B inhibitor kinase beta) (MaxLight 550)

Ask
View Details
Human VN1R3 qPCR Primer Pair
QH72317S 200 Tests

Human VN1R3 qPCR Primer Pair

Ask
View Details
Fibroblast Growth Factor 19 (FGF19) Mouse ELISA Kit
D4319 96 Tests

Fibroblast Growth Factor 19 (FGF19) Mouse ELISA Kit

Ask
View Details