Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPLX2/Complexin-2, Human (His)

Complexin-2 (CPLX2) protein plays a key role in regulating synaptic vesicle dynamics, acting as a negative regulator of synaptic vesicle cluster formation. It precisely affects vesicle localization to the presynaptic membrane. CPLX2/Complexin-2 Protein, Human (His) is the recombinant human-derived CPLX2/Complexin-2 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

CPLX2/Complexin-2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cplx2-complexin-2-protein-human-his.html

Purity

92.00

Smiles

DFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK

Molecular Formula

10814 (Gene_ID) Q6PUV4 (D2-K134) (Accession)

Molecular Weight

Approximately 21 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human PHF6 shRNA (UAS) - Lentiviral human PHF6 shRNA (UAS) (25)
GTR15082313 1 Vial

Lentiviral human PHF6 shRNA (UAS) - Lentiviral human PHF6 shRNA (UAS) (25)

Sign In for Pricing
View Details
Mouse Ppp1cb Pre-designed siRNA Set B
SI111002B 1 Each

Mouse Ppp1cb Pre-designed siRNA Set B

Sign In for Pricing
View Details
DNMT3B ELISA Kit (Mouse) (OKCD09166)
OKCD09166 96 Well

DNMT3B ELISA Kit (Mouse) (OKCD09166)

Sign In for Pricing
View Details
Dynactin p62 (H-4) HRP
sc-55603 HRP 200 µg/mL

Dynactin p62 (H-4) HRP

Sign In for Pricing
View Details
Recombinant Mouse Receptor activity-modifying protein 3 (Ramp3), partial
MBS1303776-01 0.5 mg (E-Coli)

Recombinant Mouse Receptor activity-modifying protein 3 (Ramp3), partial

Sign In for Pricing
View Details
Recombinant Mouse Receptor activity-modifying protein 3 (Ramp3), partial
MBS1303776-02 0.05 mg (Baculovirus)

Recombinant Mouse Receptor activity-modifying protein 3 (Ramp3), partial

Sign In for Pricing
View Details