Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPLX2/Complexin-2, Human (His)

Complexin-2 (CPLX2) protein plays a key role in regulating synaptic vesicle dynamics, acting as a negative regulator of synaptic vesicle cluster formation. It precisely affects vesicle localization to the presynaptic membrane. CPLX2/Complexin-2 Protein, Human (His) is the recombinant human-derived CPLX2/Complexin-2 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

CPLX2/Complexin-2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cplx2-complexin-2-protein-human-his.html

Purity

92.00

Smiles

DFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK

Molecular Formula

10814 (Gene_ID) Q6PUV4 (D2-K134) (Accession)

Molecular Weight

Approximately 21 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canadian Pesticide Mix 1 Containing 14 Compounds
CAN-CAN-1 1 mL

Canadian Pesticide Mix 1 Containing 14 Compounds

Sign In for Pricing
View Details
Forma FDE ULT Freezer 300 Boxes
FRE1026 1 Each

Forma FDE ULT Freezer 300 Boxes

Sign In for Pricing
View Details
Mi2-β (H-7) : m-IgG3 BP-HRP Bundle
sc-550360 1 Kit

Mi2-β (H-7) : m-IgG3 BP-HRP Bundle

Sign In for Pricing
View Details
Folic Acid Impurity 96
RM-F120396-01 10 mg

Folic Acid Impurity 96

Sign In for Pricing
View Details
Folic Acid Impurity 96
RM-F120396-02 25 mg

Folic Acid Impurity 96

Sign In for Pricing
View Details
Folic Acid Impurity 96
RM-F120396-03 50 mg

Folic Acid Impurity 96

Sign In for Pricing
View Details