Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPLX2/Complexin-2, Human (His)

Complexin-2 (CPLX2) protein plays a key role in regulating synaptic vesicle dynamics, acting as a negative regulator of synaptic vesicle cluster formation. It precisely affects vesicle localization to the presynaptic membrane. CPLX2/Complexin-2 Protein, Human (His) is the recombinant human-derived CPLX2/Complexin-2 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

CPLX2/Complexin-2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cplx2-complexin-2-protein-human-his.html

Purity

92.00

Smiles

DFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK

Molecular Formula

10814 (Gene_ID) Q6PUV4 (D2-K134) (Accession)

Molecular Weight

Approximately 21 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD200 Recombinant Rabbit Monoclonal Antibody [PSH05-59] - BSA and Azide free (Capture)
HA722379 100 µL

Human CD200 Recombinant Rabbit Monoclonal Antibody [PSH05-59] - BSA and Azide free (Capture)

Sign In for Pricing
View Details
LAMA4 (Laminin Subunit alpha-4, Laminin-14 Subunit alpha, Laminin-8 Subunit alpha, Laminin-9 Subunit alpha) (MaxLight 550)
128989-ML550 100 µL

LAMA4 (Laminin Subunit alpha-4, Laminin-14 Subunit alpha, Laminin-8 Subunit alpha, Laminin-9 Subunit alpha) (MaxLight 550)

Sign In for Pricing
View Details
Human TAF3 siRNA
abx935974-01 15 nmol

Human TAF3 siRNA

Sign In for Pricing
View Details
Human TAF3 siRNA
abx935974-02 30 nmol

Human TAF3 siRNA

Sign In for Pricing
View Details
CDK2AP2 (NM_001271849) Human Tagged ORF Clone
RG235454 10 µg

CDK2AP2 (NM_001271849) Human Tagged ORF Clone

Sign In for Pricing
View Details
COL12A1 Lentiviral Activation Particles (m)
sc-419734-LAC 200 µL

COL12A1 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details