Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPLX2/Complexin-2, Human (His)

Complexin-2 (CPLX2) protein plays a key role in regulating synaptic vesicle dynamics, acting as a negative regulator of synaptic vesicle cluster formation. It precisely affects vesicle localization to the presynaptic membrane. CPLX2/Complexin-2 Protein, Human (His) is the recombinant human-derived CPLX2/Complexin-2 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

CPLX2/Complexin-2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cplx2-complexin-2-protein-human-his.html

Purity

92.00

Smiles

DFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK

Molecular Formula

10814 (Gene_ID) Q6PUV4 (D2-K134) (Accession)

Molecular Weight

Approximately 21 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-p60
DB-203-0.2 200 μl

Anti-p60

Sign In for Pricing
View Details
HAO2 Rabbit Polyclonal Antibody (BF680)
orb2500373 100 µL

HAO2 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Rat Adamts8 Pre-designed siRNA Set A
SI200266A 1 Each

Rat Adamts8 Pre-designed siRNA Set A

Sign In for Pricing
View Details
YIPF6 Antibody, FITC conjugated
MBS1497544-01 0.05 mg

YIPF6 Antibody, FITC conjugated

Sign In for Pricing
View Details
YIPF6 Antibody, FITC conjugated
MBS1497544-02 0.1 mg

YIPF6 Antibody, FITC conjugated

Sign In for Pricing
View Details
YIPF6 Antibody, FITC conjugated
MBS1497544-03 5x 0.1 mg

YIPF6 Antibody, FITC conjugated

Sign In for Pricing
View Details