Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lama glama Interleukin-4 (IL4)

Product Specifications

Product Name Alternative

IL-4; B-cell stimulatory factor 1; BSF-1; Lymphocyte stimulatory factor 1)

Abbreviation

Recombinant Lama glama IL4 protein

Gene Name

IL4

UniProt

Q865X5

Expression Region

25-133aa

Organism

Lama glama (Llama)

Target Sequence

HKCDITLQEIIKTLNTLTARKNSCMELTVADVFAAPKNTTEKETFCKAATALRHIYRHHNCLSKHLSGLDRNLSGLANTTCSVNDSKKSTLRDFLERLKKIMKEKYSKC

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Positively regulates IL31RA expression in macrophages. Stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and through the induction of RUFY4.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

14.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli repA4 Polyclonal Antibody
MBS7166654 Inquire

Rabbit anti-Escherichia coli repA4 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal UCH-L3 Antibody (153) [Alexa Fluor 750]
NBP2-90679AF750 0.1 mL

Rabbit Monoclonal UCH-L3 Antibody (153) [Alexa Fluor 750]

Sign In for Pricing
View Details
Cathepsin W (CTSW, Lymphopain) (HRP)
124376-HRP 100 µL

Cathepsin W (CTSW, Lymphopain) (HRP)

Sign In for Pricing
View Details
KLF4 Rabbit mAb (AMR12836N)
AMR12836N-01 50 µL

KLF4 Rabbit mAb (AMR12836N)

Sign In for Pricing
View Details
KLF4 Rabbit mAb (AMR12836N)
AMR12836N-02 100 µL

KLF4 Rabbit mAb (AMR12836N)

Sign In for Pricing
View Details
KLF4 Rabbit mAb (AMR12836N)
AMR12836N-03 200 µL

KLF4 Rabbit mAb (AMR12836N)

Sign In for Pricing
View Details