Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Serpin A4, Human (HEK293, His)

Serpin A4 Protein inhibits tissue kallikrein's amidolytic and kininogenase activities by forming a heat- and SDS-stable equimolar complex with the enzyme. Tissue kallikrein concurrently cleaves the reactive site of Serpin A4, producing a small C-terminal fragment. The protein, existing as a monomer and occasionally forming homodimers, demonstrates its regulatory role in modulating tissue kallikrein-mediated enzymatic activities. Serpin A4 Protein, Human (HEK293, His) is the recombinant human-derived Serpin A4 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Serpin A4 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/serpin-a4-protein-human-hek-293-his.html

Purity

98.0

Smiles

QLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANADFAFRFYYLIASETPGKNIFFSPLSISAAYAMLSLGACSHSRSQILEGLGFNLTELSESDVHRGFQHLLHTLNLPGHGLETRVGSALFLSHNLKFLAKFLNDTMAVYEAKLFHTNFYDTVGTIQLINDHVKKETRGKIVDLVSELKKDVLMVLVNYIYFKALWEKPFISSRTTPKDFYVDENTTVRVPMMLQDQEHHWYLHDRYLPCSVLRMDYKGDATVFFILPNQGKMREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLPKFSISGSYVLDQILPRLGFTDLFSKWADLSGITKQQKLEASKSFHKATLDVDEAGTEAAAATSFAIKFFSAQTNRHILRFNRPFLVVIFSTSTQSVLFLGKVVDPTKP

Molecular Formula

5267 (Gene_ID) P29622 (Q21-P427) (Accession)

Molecular Weight

Approximately 50-80 kDa & 120-150 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TOP1MT Protein Lysate (Mouse) with C-HA Tag
47303034 100 µg

TOP1MT Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Chlorotriphenylstannane
TRC-C422250-250MG 250 mg

Chlorotriphenylstannane

Sign In for Pricing
View Details
1,2:5,6-Di-O-isopropylidene-a-D-ribo-hexofuranose-3-ulose (mixture of keto and ketal forms)
MBS6036697-01 2.5 g

1,2:5,6-Di-O-isopropylidene-a-D-ribo-hexofuranose-3-ulose (mixture of keto and ketal forms)

Sign In for Pricing
View Details
1,2:5,6-Di-O-isopropylidene-a-D-ribo-hexofuranose-3-ulose (mixture of keto and ketal forms)
MBS6036697-02 5x 2.5 g

1,2:5,6-Di-O-isopropylidene-a-D-ribo-hexofuranose-3-ulose (mixture of keto and ketal forms)

Sign In for Pricing
View Details
Rabbit Polyclonal GGT1 Antibody [Alexa Fluor 700]
NBP2-98438AF700 0.1 mL

Rabbit Polyclonal GGT1 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
GAGE12H, NT (GAGE12H, G antigen 12H) (MaxLight 750) discontinued
035872-ML750 100 µL

GAGE12H, NT (GAGE12H, G antigen 12H) (MaxLight 750) discontinued

Sign In for Pricing
View Details