Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Serpin A4, Human (HEK293, His)

Serpin A4 Protein inhibits tissue kallikrein's amidolytic and kininogenase activities by forming a heat- and SDS-stable equimolar complex with the enzyme. Tissue kallikrein concurrently cleaves the reactive site of Serpin A4, producing a small C-terminal fragment. The protein, existing as a monomer and occasionally forming homodimers, demonstrates its regulatory role in modulating tissue kallikrein-mediated enzymatic activities. Serpin A4 Protein, Human (HEK293, His) is the recombinant human-derived Serpin A4 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Serpin A4 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/serpin-a4-protein-human-hek-293-his.html

Purity

98.0

Smiles

QLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANADFAFRFYYLIASETPGKNIFFSPLSISAAYAMLSLGACSHSRSQILEGLGFNLTELSESDVHRGFQHLLHTLNLPGHGLETRVGSALFLSHNLKFLAKFLNDTMAVYEAKLFHTNFYDTVGTIQLINDHVKKETRGKIVDLVSELKKDVLMVLVNYIYFKALWEKPFISSRTTPKDFYVDENTTVRVPMMLQDQEHHWYLHDRYLPCSVLRMDYKGDATVFFILPNQGKMREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLPKFSISGSYVLDQILPRLGFTDLFSKWADLSGITKQQKLEASKSFHKATLDVDEAGTEAAAATSFAIKFFSAQTNRHILRFNRPFLVVIFSTSTQSVLFLGKVVDPTKP

Molecular Formula

5267 (Gene_ID) P29622 (Q21-P427) (Accession)

Molecular Weight

Approximately 50-80 kDa & 120-150 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rai12 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
38454156 3x 1.0 µg DNA

Rai12 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Lentiviral human CCDC42 shRNA (UAS) - Lentiviral human CCDC42 shRNA (UAS, RFP) plasmid
GTR15314896 1 Vial

Lentiviral human CCDC42 shRNA (UAS) - Lentiviral human CCDC42 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Rabbit Polyclonal SNX2 Antibody [Alexa Fluor 405]
NBP2-24514AF405 0.1 mL

Rabbit Polyclonal SNX2 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
HTR2A Protein Vector (Human) (pPB-N-His)
PV020586 500 ng

HTR2A Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Bovine Breast Cancer Susceptibility Protein 2 (BRCA2) ELISA Kit
NSL2065Bo 96 Tests

Bovine Breast Cancer Susceptibility Protein 2 (BRCA2) ELISA Kit

Sign In for Pricing
View Details
Rat Anti-Actin Antibody ELISA Kit
MBS726749-01 48 Well

Rat Anti-Actin Antibody ELISA Kit

Sign In for Pricing
View Details