Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Serpin A4, Human (HEK293, His)

Serpin A4 Protein inhibits tissue kallikrein's amidolytic and kininogenase activities by forming a heat- and SDS-stable equimolar complex with the enzyme. Tissue kallikrein concurrently cleaves the reactive site of Serpin A4, producing a small C-terminal fragment. The protein, existing as a monomer and occasionally forming homodimers, demonstrates its regulatory role in modulating tissue kallikrein-mediated enzymatic activities. Serpin A4 Protein, Human (HEK293, His) is the recombinant human-derived Serpin A4 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Serpin A4 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/serpin-a4-protein-human-hek-293-his.html

Purity

98.0

Smiles

QLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANADFAFRFYYLIASETPGKNIFFSPLSISAAYAMLSLGACSHSRSQILEGLGFNLTELSESDVHRGFQHLLHTLNLPGHGLETRVGSALFLSHNLKFLAKFLNDTMAVYEAKLFHTNFYDTVGTIQLINDHVKKETRGKIVDLVSELKKDVLMVLVNYIYFKALWEKPFISSRTTPKDFYVDENTTVRVPMMLQDQEHHWYLHDRYLPCSVLRMDYKGDATVFFILPNQGKMREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLPKFSISGSYVLDQILPRLGFTDLFSKWADLSGITKQQKLEASKSFHKATLDVDEAGTEAAAATSFAIKFFSAQTNRHILRFNRPFLVVIFSTSTQSVLFLGKVVDPTKP

Molecular Formula

5267 (Gene_ID) P29622 (Q21-P427) (Accession)

Molecular Weight

Approximately 50-80 kDa & 120-150 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse B-Cell CLL/Lymphoma 9 (Bcl9) ELISA Kit
abx153703-01 96 Tests

Mouse B-Cell CLL/Lymphoma 9 (Bcl9) ELISA Kit

Sign In for Pricing
View Details
Mouse B-Cell CLL/Lymphoma 9 (Bcl9) ELISA Kit
abx153703-02 5x 96 Tests

Mouse B-Cell CLL/Lymphoma 9 (Bcl9) ELISA Kit

Sign In for Pricing
View Details
Mouse B-Cell CLL/Lymphoma 9 (Bcl9) ELISA Kit
abx153703-03 10x 96 Tests

Mouse B-Cell CLL/Lymphoma 9 (Bcl9) ELISA Kit

Sign In for Pricing
View Details
TTLL8, NT (TTLL8, Protein monoglycylase TTLL8, Tubulin-tyrosine ligase-like protein 8) (AP)
MBS6360057-01 0.2 mL

TTLL8, NT (TTLL8, Protein monoglycylase TTLL8, Tubulin-tyrosine ligase-like protein 8) (AP)

Sign In for Pricing
View Details
TTLL8, NT (TTLL8, Protein monoglycylase TTLL8, Tubulin-tyrosine ligase-like protein 8) (AP)
MBS6360057-02 5x 0.2 mL

TTLL8, NT (TTLL8, Protein monoglycylase TTLL8, Tubulin-tyrosine ligase-like protein 8) (AP)

Sign In for Pricing
View Details
Mmu-miR-224-3p inhibitor
HY-RI02849-01 5 nmol

Mmu-miR-224-3p inhibitor

Sign In for Pricing
View Details