Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Serpin A4, Human (HEK293, His)

Serpin A4 Protein inhibits tissue kallikrein's amidolytic and kininogenase activities by forming a heat- and SDS-stable equimolar complex with the enzyme. Tissue kallikrein concurrently cleaves the reactive site of Serpin A4, producing a small C-terminal fragment. The protein, existing as a monomer and occasionally forming homodimers, demonstrates its regulatory role in modulating tissue kallikrein-mediated enzymatic activities. Serpin A4 Protein, Human (HEK293, His) is the recombinant human-derived Serpin A4 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Serpin A4 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/serpin-a4-protein-human-hek-293-his.html

Purity

98.0

Smiles

QLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANADFAFRFYYLIASETPGKNIFFSPLSISAAYAMLSLGACSHSRSQILEGLGFNLTELSESDVHRGFQHLLHTLNLPGHGLETRVGSALFLSHNLKFLAKFLNDTMAVYEAKLFHTNFYDTVGTIQLINDHVKKETRGKIVDLVSELKKDVLMVLVNYIYFKALWEKPFISSRTTPKDFYVDENTTVRVPMMLQDQEHHWYLHDRYLPCSVLRMDYKGDATVFFILPNQGKMREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLPKFSISGSYVLDQILPRLGFTDLFSKWADLSGITKQQKLEASKSFHKATLDVDEAGTEAAAATSFAIKFFSAQTNRHILRFNRPFLVVIFSTSTQSVLFLGKVVDPTKP

Molecular Formula

5267 (Gene_ID) P29622 (Q21-P427) (Accession)

Molecular Weight

Approximately 50-80 kDa & 120-150 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGR2 sgRNA CRISPR Lentivector set (Human)
K0005901 3x 1.0 µg

EGR2 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
ACOT11 HDR Plasmid (h)
sc-406653-HDR 20 µg

ACOT11 HDR Plasmid (h)

Sign In for Pricing
View Details
Cebpb (NM_009883) Mouse Tagged Lenti ORF Clone
MR227563L2 10 µg

Cebpb (NM_009883) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-BACE1 Mouse mAb
MBS476531-01 0.1 mL

Anti-BACE1 Mouse mAb

Sign In for Pricing
View Details
Anti-BACE1 Mouse mAb
MBS476531-02 5x 0.1 mL

Anti-BACE1 Mouse mAb

Sign In for Pricing
View Details
SLC25A10 Protein Lysate (Human) with C-Ha Tag
43978031 100 µg

SLC25A10 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details