Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFER, Human (HEK293, His)

GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GFER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfer-protein-human-hek293-c-his.html

Purity

96.00

Smiles

MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Molecular Formula

2671 (Gene_ID) P55789-2 (M1-D125) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCMV6-LRPPRC-3*FLAG
BZ65001 1 Vial

PCMV6-LRPPRC-3*FLAG

Sign In for Pricing
View Details
Anti-DGCR8 antibody
PAab02352 100 µg

Anti-DGCR8 antibody

Sign In for Pricing
View Details
SLC29A4P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV748673 1.0 µg DNA

SLC29A4P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
4-Chlorocinnamic acid
MBS5788675 Inquire

4-Chlorocinnamic acid

Sign In for Pricing
View Details
Mouse Tmem89 Pre-designed siRNA Set A
SI114950A 1 Each

Mouse Tmem89 Pre-designed siRNA Set A

Sign In for Pricing
View Details
UBXN2B Antibody; HRP conjugated
MBS7001684-01 0.05 mg

UBXN2B Antibody; HRP conjugated

Sign In for Pricing
View Details