Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFER, Human (HEK293, His)

GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GFER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfer-protein-human-hek293-c-his.html

Purity

96.00

Smiles

MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Molecular Formula

2671 (Gene_ID) P55789-2 (M1-D125) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

B4GALT5  polyclonal antibody
BS77340 50ul

B4GALT5 polyclonal antibody

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) GLR3.3 Polyclonal Antibody
MBS9009047 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) GLR3.3 Polyclonal Antibody

Sign In for Pricing
View Details
Mono-2-hydroxybutyl Phthalate
TRC-M547515-250MG 250 mg

Mono-2-hydroxybutyl Phthalate

Sign In for Pricing
View Details
Heat Shock Protein 27, phosphorylated (Ser82) (HSP27)
MBS627932-01 10 Blots

Heat Shock Protein 27, phosphorylated (Ser82) (HSP27)

Sign In for Pricing
View Details
Heat Shock Protein 27, phosphorylated (Ser82) (HSP27)
MBS627932-02 5x 10 Blots

Heat Shock Protein 27, phosphorylated (Ser82) (HSP27)

Sign In for Pricing
View Details
KRTAP8-2P Protein Vector (Human) (pPM-C-HA)
PV090256 500 ng

KRTAP8-2P Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details