Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFER, Human (HEK293, His)

GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GFER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfer-protein-human-hek293-c-his.html

Purity

96.00

Smiles

MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Molecular Formula

2671 (Gene_ID) P55789-2 (M1-D125) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPL52 antibody
70R-18616 50 ul

MRPL52 antibody

Sign In for Pricing
View Details
Zfp64 (NM_009564) Mouse Tagged ORF Clone Lentiviral Particle
MR223441L4V 200 µL

Zfp64 (NM_009564) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Human SulT2B1 Protein, His Tag
KMH1770-01 100 µg

Recombinant Human SulT2B1 Protein, His Tag

Sign In for Pricing
View Details
Recombinant Human SulT2B1 Protein, His Tag
KMH1770-02 50 µg

Recombinant Human SulT2B1 Protein, His Tag

Sign In for Pricing
View Details
Rat monoclonal CD43 antibody
MBS5305559-01 0.05 mg

Rat monoclonal CD43 antibody

Sign In for Pricing
View Details
Rat monoclonal CD43 antibody
MBS5305559-02 0.1 mg

Rat monoclonal CD43 antibody

Sign In for Pricing
View Details