GFER, Human (HEK293, His)

GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GFER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfer-protein-human-hek293-c-his.html

Purity

96.00

Smiles

MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Molecular Formula

2671 (Gene_ID) P55789-2 (M1-D125) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

128058-ML490 100 µL

HPGD (15-hydroxyprostaglandin Dehydrogenase [NAD+], 15-PGDH, Prostaglandin Dehydrogenase 1, PGDH1) (MaxLight 490)

View Details

MF-0005257 1 g

2,5-Furandicarboxylic acid

View Details

C2412-06T-ML405 100 µL

CD58 (CD58 Antigen, Ag3, Lymphocyte Function Associated Antigen Type 3, LFA3, LFA-3, Surface Glycoprotein LFA-3) (MaxLight 405) discontinued

View Details

GTR15078968 1 Vial

Lentiviral human NUDT17 shRNA (UAS) - Lentiviral human NUDT17 shRNA (UAS, GFP) (25)

View Details

MBS6313906-01 0.1 mL

KLF1, CT (KLF1, EKLF, Krueppel-like factor 1, Erythroid krueppel-like transcription factor) (MaxLight 750)

View Details

MBS6313906-02 5x 0.1 mL

KLF1, CT (KLF1, EKLF, Krueppel-like factor 1, Erythroid krueppel-like transcription factor) (MaxLight 750)

View Details