Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFER, Human (HEK293, His)

GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GFER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfer-protein-human-hek293-c-his.html

Purity

96.00

Smiles

MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Molecular Formula

2671 (Gene_ID) P55789-2 (M1-D125) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse EphA3 MAb (Clone 99437)
MAB640-SP 25 µg

Mouse EphA3 MAb (Clone 99437)

Sign In for Pricing
View Details
Recombinant ASFV Pret-087 Protein (aa 1-438)
VAng-2378Lsx-500g 500 µg

Recombinant ASFV Pret-087 Protein (aa 1-438)

Sign In for Pricing
View Details
Parp1 Knockout CT26 Cell Line
ARG0204 1 Million

Parp1 Knockout CT26 Cell Line

Sign In for Pricing
View Details
Lentiviral mouse Zbtb44 shRNA (UAS) - Lentiviral mouse Zbtb44 shRNA (UAS, RFP) (25)
GTR15185699 1 Vial

Lentiviral mouse Zbtb44 shRNA (UAS) - Lentiviral mouse Zbtb44 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
ZNF319 Peptide - N-terminal region
MBS3234984-01 0.1 mg

ZNF319 Peptide - N-terminal region

Sign In for Pricing
View Details
ZNF319 Peptide - N-terminal region
MBS3234984-02 5x 0.1 mg

ZNF319 Peptide - N-terminal region

Sign In for Pricing
View Details