Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFER, Human (HEK293, His)

GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GFER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfer-protein-human-hek293-c-his.html

Purity

96.00

Smiles

MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Molecular Formula

2671 (Gene_ID) P55789-2 (M1-D125) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Frizzled-3, FZD3 ELISA KIT
ELI-27178h 96 Tests

Human Frizzled-3, FZD3 ELISA KIT

Sign In for Pricing
View Details
PPFIA1 (Protein Tyrosine Phosphatase Receptor Type F Polypeptide-interacting Protein alpha-1, LIP1, LIP.1, Liprin) (MaxLight 550)
MBS6432487-01 0.1 mL

PPFIA1 (Protein Tyrosine Phosphatase Receptor Type F Polypeptide-interacting Protein alpha-1, LIP1, LIP.1, Liprin) (MaxLight 550)

Sign In for Pricing
View Details
PPFIA1 (Protein Tyrosine Phosphatase Receptor Type F Polypeptide-interacting Protein alpha-1, LIP1, LIP.1, Liprin) (MaxLight 550)
MBS6432487-02 5x 0.1 mL

PPFIA1 (Protein Tyrosine Phosphatase Receptor Type F Polypeptide-interacting Protein alpha-1, LIP1, LIP.1, Liprin) (MaxLight 550)

Sign In for Pricing
View Details
Anti-ENO1  (8G3)
YF-MA12850 200 ul

Anti-ENO1 (8G3)

Sign In for Pricing
View Details
Sterol carrier protein 2 Peptide
abx615544 100 µg

Sterol carrier protein 2 Peptide

Sign In for Pricing
View Details
PPM1L (NM_139245) Human Mass Spec Standard
PH318909 10 µg

PPM1L (NM_139245) Human Mass Spec Standard

Sign In for Pricing
View Details