Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFER, Human (HEK293, His)

GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GFER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfer-protein-human-hek293-c-his.html

Purity

96.00

Smiles

MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Molecular Formula

2671 (Gene_ID) P55789-2 (M1-D125) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AR (Acetyl Lys633) Polyclonal Antibody
ABP57802-01 30 µL

AR (Acetyl Lys633) Polyclonal Antibody

Sign In for Pricing
View Details
AR (Acetyl Lys633) Polyclonal Antibody
ABP57802-02 100 µL

AR (Acetyl Lys633) Polyclonal Antibody

Sign In for Pricing
View Details
AR (Acetyl Lys633) Polyclonal Antibody
ABP57802-03 200 µL

AR (Acetyl Lys633) Polyclonal Antibody

Sign In for Pricing
View Details
Rat Monoclonal CD79B Antibody (735451) [PE/Atto594]
FAB6814PEATT594 0.1 mL

Rat Monoclonal CD79B Antibody (735451) [PE/Atto594]

Sign In for Pricing
View Details
Renin (REN) (NM_000537) Human Tagged ORF Clone Lentiviral Particle
RC208382L2V 200 µL

Renin (REN) (NM_000537) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
C21orf70 (FAM207A) (NM_058190) Human Recombinant Protein
TP303664M 100 µg

C21orf70 (FAM207A) (NM_058190) Human Recombinant Protein

Sign In for Pricing
View Details