GFER, Human (HEK293, His)
GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
GFER Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gfer-protein-human-hek293-c-his.html
Purity
96.00
Smiles
MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD
Molecular Formula
2671 (Gene_ID) P55789-2 (M1-D125) (Accession)
Molecular Weight
Approximately 16 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
LH13804V 100 µg
C7orf30 (MALSU1) (NM_138446) Human Over-expression Lysate
Sign In for Pricing
View Details 
APR07470G 0.05ml
Monoclonal CYPOR / POR Antibody (clone 6C4), Clone: 6C4
Sign In for Pricing
View Details ![Mouse Monoclonal NM23-H2/NME2 Antibody (CPTC-NME2-2) [DyLight 594]](https://cdn.genprice.uk/genprice/uk/genprice3.webp)
NBP2-79873DL594 0.1 mL
Mouse Monoclonal NM23-H2/NME2 Antibody (CPTC-NME2-2) [DyLight 594]
Sign In for Pricing
View Details 
K2136802 1.0 µg DNA
SGK2 sgRNA CRISPR Lentivector (Human) (Target 1)
Sign In for Pricing
View Details