Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFER, Human (HEK293, His)

GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GFER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfer-protein-human-hek293-c-his.html

Purity

96.00

Smiles

MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Molecular Formula

2671 (Gene_ID) P55789-2 (M1-D125) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C6orf115 Polyclonal Antibody
MBS9235447-01 0.1 mL

C6orf115 Polyclonal Antibody

Sign In for Pricing
View Details
C6orf115 Polyclonal Antibody
MBS9235447-02 5x 0.1 mL

C6orf115 Polyclonal Antibody

Sign In for Pricing
View Details
Human Probable Hydrolase PNKD,PNKD ELISA KIT
JOT-EK4551Hu 96 wells

Human Probable Hydrolase PNKD,PNKD ELISA KIT

Sign In for Pricing
View Details
Caspase 6 Cleaved-Asp162 (CASP6 Cleaved-D162) Antibody
abx015535-01 10 µg

Caspase 6 Cleaved-Asp162 (CASP6 Cleaved-D162) Antibody

Sign In for Pricing
View Details
Caspase 6 Cleaved-Asp162 (CASP6 Cleaved-D162) Antibody
abx015535-02 100 µg

Caspase 6 Cleaved-Asp162 (CASP6 Cleaved-D162) Antibody

Sign In for Pricing
View Details
Caspase 6 Cleaved-Asp162 (CASP6 Cleaved-D162) Antibody
abx015535-03 200 µg

Caspase 6 Cleaved-Asp162 (CASP6 Cleaved-D162) Antibody

Sign In for Pricing
View Details