GFER, Human (HEK293, His)
GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
GFER Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gfer-protein-human-hek293-c-his.html
Purity
96.00
Smiles
MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD
Molecular Formula
2671 (Gene_ID) P55789-2 (M1-D125) (Accession)
Molecular Weight
Approximately 16 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6289723-01 0.1 mL
CTDSPL, NT (CTDSPL, C3orf8, NIF1, NIFL, SCP3, YA22, CTD small phosphatase-like protein, Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 3, NIF-like protein, Nuclear LIM interactor-interacting factor 1, Protein YA22, RBSP3, Small
Sign In for Pricing
View Details 
MBS6289723-02 5x 0.1 mL
CTDSPL, NT (CTDSPL, C3orf8, NIF1, NIFL, SCP3, YA22, CTD small phosphatase-like protein, Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 3, NIF-like protein, Nuclear LIM interactor-interacting factor 1, Protein YA22, RBSP3, Small
Sign In for Pricing
View Details 
TA328127 400 µL
FAK (PTK2) Mouse Monoclonal Antibody [Clone ID: 1297CT261.163.145]
Sign In for Pricing
View Details K4183407 1.0 µg DNA
Olfr884 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
Sign In for Pricing
View Details