Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFER, Human (HEK293, His)

GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GFER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfer-protein-human-hek293-c-his.html

Purity

96.00

Smiles

MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Molecular Formula

2671 (Gene_ID) P55789-2 (M1-D125) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Dog IgG (H+L) antibody
STJ99564-1mL 1 mL

Rabbit Anti-Dog IgG (H+L) antibody

Sign In for Pricing
View Details
SPINT1 3'UTR GFP Stable Cell Line
TU074503 1.0 mL

SPINT1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mouse Monoclonal RhoGDI Antibody (2G3)
NBP2-37472 0.1 mL

Mouse Monoclonal RhoGDI Antibody (2G3)

Sign In for Pricing
View Details
Porcine Slit Homolog 2 (Slit2) ELISA Kit
EIA06347p 1 Kit

Porcine Slit Homolog 2 (Slit2) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal TEM7/PLXDC1 Antibody [DyLight 594]
NBP2-99868DL594 0.1 mL

Rabbit Polyclonal TEM7/PLXDC1 Antibody [DyLight 594]

Sign In for Pricing
View Details
pEnCMV-mCherry-Linker-LGALS3-SV40-Neo Plasmid
PVT39541 2 µg

pEnCMV-mCherry-Linker-LGALS3-SV40-Neo Plasmid

Sign In for Pricing
View Details