Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFER, Human (HEK293, His)

GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GFER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfer-protein-human-hek293-c-his.html

Purity

96.00

Smiles

MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Molecular Formula

2671 (Gene_ID) P55789-2 (M1-D125) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHC2 ORF Vector (Human) (pORF)
43702011 1.0 µg DNA

SHC2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Bovine Universal Reference cDNA-Oligo dT
BD-UR-40 30 Reactions

Bovine Universal Reference cDNA-Oligo dT

Sign In for Pricing
View Details
Beta TRCP (BTRC) (NM_003939) Human Tagged Lenti ORF Clone
RC214799L3 10 µg

Beta TRCP (BTRC) (NM_003939) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ER beta polyclonal antibody
BZ16355-01 50 µL

ER beta polyclonal antibody

Sign In for Pricing
View Details
ER beta polyclonal antibody
BZ16355-02 100 µL

ER beta polyclonal antibody

Sign In for Pricing
View Details
FBRSL1 (C-term) Rabbit Polyclonal Antibody
AP51617PU-N 400 µL

FBRSL1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details