Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFER, Human (HEK293, His)

GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GFER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfer-protein-human-hek293-c-his.html

Purity

96.00

Smiles

MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Molecular Formula

2671 (Gene_ID) P55789-2 (M1-D125) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC677017 Mouse siRNA Oligo Duplex (Locus ID 677017)
SR401966 1 Kit

LOC677017 Mouse siRNA Oligo Duplex (Locus ID 677017)

Sign In for Pricing
View Details
LARP7 Antibody Affinity Purified
MBS541977-01 0.1 mg

LARP7 Antibody Affinity Purified

Sign In for Pricing
View Details
LARP7 Antibody Affinity Purified
MBS541977-02 5x 0.1 mg

LARP7 Antibody Affinity Purified

Sign In for Pricing
View Details
SARDH (NM_001134707) Human Untagged Clone
SC325369 10 µg

SARDH (NM_001134707) Human Untagged Clone

Sign In for Pricing
View Details
IGKV1-13 sgRNA CRISPR Lentivector (Human) (Target 2)
K1051103 1.0 µg DNA

IGKV1-13 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
PTLAH Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV742061 1.0 µg DNA

PTLAH Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details