Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFER, Human (HEK293, His)

GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GFER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfer-protein-human-hek293-c-his.html

Purity

96.00

Smiles

MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Molecular Formula

2671 (Gene_ID) P55789-2 (M1-D125) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Polyclonal NME6 Antibody
H00010201-B02P 0.05 mg

Mouse Polyclonal NME6 Antibody

Sign In for Pricing
View Details
Zfp386 Protein Lysate (Mouse) with C-HA Tag
50952034 100 µg

Zfp386 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Anti-PSMA3 antibody
STJ25172 100 µl

Anti-PSMA3 antibody

Sign In for Pricing
View Details
SQSTM1/p62 Rabbit pAb
A7758-01 20 µL

SQSTM1/p62 Rabbit pAb

Sign In for Pricing
View Details
SQSTM1/p62 Rabbit pAb
A7758-02 100 μL

SQSTM1/p62 Rabbit pAb

Sign In for Pricing
View Details
SQSTM1/p62 Rabbit pAb
A7758-03 500 μL

SQSTM1/p62 Rabbit pAb

Sign In for Pricing
View Details