GFER, Human (HEK293, His)

GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GFER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfer-protein-human-hek293-c-his.html

Purity

96.00

Smiles

MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Molecular Formula

2671 (Gene_ID) P55789-2 (M1-D125) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABP-S-07682 5 Plates

Distemper Virus Distemper Virus Matched Antibody Pair Set [ABP-S-07682]

View Details

MBS335116-01 200 Tests

Mouse Anti-Human CD34 Class I Monoclonal Antibody, Unconjugated Clone B-C34

View Details

MBS335116-02 5x 200 Tests

Mouse Anti-Human CD34 Class I Monoclonal Antibody, Unconjugated Clone B-C34

View Details

RC222461L3V 200 µL

CHMP7 (NM_152272) Human Tagged ORF Clone Lentiviral Particle

View Details

VAng-Lsx7220-500gEcoli 500 µg (E. coli)

Recombinant Chlamydophila Trachomatis rpsN Protein (aa 1-101) (strain UCH-1/proctitis)

View Details

RA21991-01 50 µL

ApoL1 Monoclonal Antibody

View Details