Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFER, Human (HEK293, His)

GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GFER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfer-protein-human-hek293-c-his.html

Purity

96.00

Smiles

MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Molecular Formula

2671 (Gene_ID) P55789-2 (M1-D125) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OXSM Mouse Monoclonal Antibody [Clone ID: OTI1G5]
CF802187 100 µg

OXSM Mouse Monoclonal Antibody [Clone ID: OTI1G5]

Sign In for Pricing
View Details
Enkd1 (NM_198299) Mouse Recombinant Protein
TP505213 20 µg

Enkd1 (NM_198299) Mouse Recombinant Protein

Sign In for Pricing
View Details
MRG15 (MORF4L1) Rabbit Polyclonal Antibody
TA367496 100 µL

MRG15 (MORF4L1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PcDNA3.1 (+) -ZNF207 (isoform c) -Flag
PPL02057-2c 1 Each

PcDNA3.1 (+) -ZNF207 (isoform c) -Flag

Sign In for Pricing
View Details
Anti-CCR5 (NT) Antibody
1112-1 100 µg

Anti-CCR5 (NT) Antibody

Sign In for Pricing
View Details
Mouse Monoclonal CA125/MUC16 Antibody (986808) [PerCP]
FAB5609C 0.1 mL

Mouse Monoclonal CA125/MUC16 Antibody (986808) [PerCP]

Sign In for Pricing
View Details