GFER, Human (HEK293, His)
GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
GFER Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gfer-protein-human-hek293-c-his.html
Purity
96.00
Smiles
MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD
Molecular Formula
2671 (Gene_ID) P55789-2 (M1-D125) (Accession)
Molecular Weight
Approximately 16 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Rabbit Monoclonal EpCAM/TROP1 Antibody (EGP40/1556R) [Alexa Fluor 700]](https://cdn.genprice.uk/genprice/uk/genprice3.webp)
NBP2-54425AF700 100 µL
Rabbit Monoclonal EpCAM/TROP1 Antibody (EGP40/1556R) [Alexa Fluor 700]
Sign In for Pricing
View Details FAB10501M 0.1 mL
Rabbit Monoclonal APCDD1 Antibody (2584B) [DyLight 594]
Sign In for Pricing
View Details 
A0855-91C 100 µg
Activin A Receptor, Type II-like Kinase 2 (Activin A Receptor Type I, ACVR1, ACTRI, ACVRLK2, ALK2, FOP, SKR1, hydroxyalkyl-protein kinase) discontinued
Sign In for Pricing
View Details