Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFER, Human (HEK293, His)

GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GFER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfer-protein-human-hek293-c-his.html

Purity

96.00

Smiles

MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Molecular Formula

2671 (Gene_ID) P55789-2 (M1-D125) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adenine Nucleotide Translocator 2 (SLC25A5) Human qPCR Template Standard (NM_001152)
HK206785 1 Kit

Adenine Nucleotide Translocator 2 (SLC25A5) Human qPCR Template Standard (NM_001152)

Sign In for Pricing
View Details
Anti-Cluster Of Differentiation 59 (CD59)
FY-AB44452-01 1 mL

Anti-Cluster Of Differentiation 59 (CD59)

Sign In for Pricing
View Details
Anti-Cluster Of Differentiation 59 (CD59)
FY-AB44452-02 100 µL

Anti-Cluster Of Differentiation 59 (CD59)

Sign In for Pricing
View Details
Anti-Cluster Of Differentiation 59 (CD59)
FY-AB44452-03 200 µL

Anti-Cluster Of Differentiation 59 (CD59)

Sign In for Pricing
View Details
Tissue, Section, Human Disease, Multiple Sclerosis, Brain, Postcentral Gyrus (Frozen) HisTekTM
T5595-5227N 5 Slides

Tissue, Section, Human Disease, Multiple Sclerosis, Brain, Postcentral Gyrus (Frozen) HisTekTM

Sign In for Pricing
View Details
Porcine TNF related activation induced cytokine (TRANCE) ELISA Kit
EIA06476p 1 Kit

Porcine TNF related activation induced cytokine (TRANCE) ELISA Kit

Sign In for Pricing
View Details