Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFER, Human (HEK293, His)

GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GFER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfer-protein-human-hek293-c-his.html

Purity

96.00

Smiles

MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Molecular Formula

2671 (Gene_ID) P55789-2 (M1-D125) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal RPAIN Antibody [mFluor Violet 450 SE]
NBP1-76749MFV450 0.1 mL

Rabbit Polyclonal RPAIN Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Porcine cytokeratin 20 (CK-20) ELISA Kit
EIA05484p 1 Kit

Porcine cytokeratin 20 (CK-20) ELISA Kit

Sign In for Pricing
View Details
GET3 CytoSection
TS401194P5 25 Slides

GET3 CytoSection

Sign In for Pricing
View Details
Fuc-GM1 Sphingosine (d18:1)
HY-N15901 1 Each

Fuc-GM1 Sphingosine (d18:1)

Sign In for Pricing
View Details
CARM1 Antibody
E38QA2811 100 µL

CARM1 Antibody

Sign In for Pricing
View Details
Human CD262/TNFRSF10B/TRAIL-R2 Antibody , APC
E55A07959 50 Tests

Human CD262/TNFRSF10B/TRAIL-R2 Antibody , APC

Sign In for Pricing
View Details