Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFER, Human (HEK293, His)

GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GFER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfer-protein-human-hek293-c-his.html

Purity

96.00

Smiles

MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Molecular Formula

2671 (Gene_ID) P55789-2 (M1-D125) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRN3 Antibody, Biotin conjugated
A69450-100UG 100 µg

LRRN3 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Lentiviral human CNTNAP1 shRNA (UAS) - Lentiviral human CNTNAP1 shRNA (UAS, iRFP) plasmid
GTR15346015 1 Vial

Lentiviral human CNTNAP1 shRNA (UAS) - Lentiviral human CNTNAP1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Interleukin 6 Receptor, gp80, non-neutralizing (CD126, IL-6R) (MaxLight 490) discontinued
I8428-39C-ML490 100 µL

Interleukin 6 Receptor, gp80, non-neutralizing (CD126, IL-6R) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal Pleiotrophin/PTN Antibody
NBP1-58286 100 µL

Rabbit Polyclonal Pleiotrophin/PTN Antibody

Sign In for Pricing
View Details
PARD3 3'UTR Luciferase Stable Cell Line
TU017389 1.0 mL

PARD3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
SOX9 Mouse Monoclonal Antibody [Clone ID: OTI5G4]
TA802491S 30 µL

SOX9 Mouse Monoclonal Antibody [Clone ID: OTI5G4]

Sign In for Pricing
View Details