Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFER, Human (HEK293, His)

GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GFER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfer-protein-human-hek293-c-his.html

Purity

96.00

Smiles

MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Molecular Formula

2671 (Gene_ID) P55789-2 (M1-D125) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr129 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV633598 1.0 µg DNA

Olr129 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
HMGXB3, ID (HMGXB3, KIAA0194, SMF, HMG domain-containing protein 3, HMG box-containing protein 3, Protein SMF) (MaxLight 750) discontinued
036649-ML750 100 µL

HMGXB3, ID (HMGXB3, KIAA0194, SMF, HMG domain-containing protein 3, HMG box-containing protein 3, Protein SMF) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Recombinant Mouse SCF/c-Kit Ligand Protein
PKSM041151-01 10 µg

Recombinant Mouse SCF/c-Kit Ligand Protein

Sign In for Pricing
View Details
Recombinant Mouse SCF/c-Kit Ligand Protein
PKSM041151-02 50 µg

Recombinant Mouse SCF/c-Kit Ligand Protein

Sign In for Pricing
View Details
GRIA1 Protein Vector (Mouse) (pPM-C-HA)
PV186596 500 ng

GRIA1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
ITGA4 (Integrin, alpha 4 (antigen CD49D, alpha 4 Subunit of VLA-4 Receptor), CD49D, IA4, MGC90518) (AP)
MBS6165084-01 0.1 mL

ITGA4 (Integrin, alpha 4 (antigen CD49D, alpha 4 Subunit of VLA-4 Receptor), CD49D, IA4, MGC90518) (AP)

Sign In for Pricing
View Details