Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFER, Human (HEK293, His)

GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GFER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfer-protein-human-hek293-c-his.html

Purity

96.00

Smiles

MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Molecular Formula

2671 (Gene_ID) P55789-2 (M1-D125) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glucagon Mouse Monoclonal Antibody [KD Validation]
E51K2878 40 µL

Glucagon Mouse Monoclonal Antibody [KD Validation]

Sign In for Pricing
View Details
4-ArmPEG-AC, 10K
A44009-10K-01 1 g

4-ArmPEG-AC, 10K

Sign In for Pricing
View Details
4-ArmPEG-AC, 10K
A44009-10K-02 5 g

4-ArmPEG-AC, 10K

Sign In for Pricing
View Details
OR1Q1 Protein Vector (Human) (pPB-N-His)
PV106351 500 ng

OR1Q1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
PRKAB2 Antibody / AMPK beta 2
RQ4500 100 µg

PRKAB2 Antibody / AMPK beta 2

Sign In for Pricing
View Details
Rabbit Polyclonal Frk Antibody
NBP2-68617-25ul 25 µL

Rabbit Polyclonal Frk Antibody

Sign In for Pricing
View Details