Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFER, Human (HEK293, His)

GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GFER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfer-protein-human-hek293-c-his.html

Purity

96.00

Smiles

MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Molecular Formula

2671 (Gene_ID) P55789-2 (M1-D125) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster Anti-Mouse CD30
31-1855-0.5 0.5 mg

Hamster Anti-Mouse CD30

Sign In for Pricing
View Details
SOX8, ID (SOX8, Transcription factor SOX-8) (APC)
MBS6350097-01 0.2 mL

SOX8, ID (SOX8, Transcription factor SOX-8) (APC)

Sign In for Pricing
View Details
SOX8, ID (SOX8, Transcription factor SOX-8) (APC)
MBS6350097-02 5x 0.2 mL

SOX8, ID (SOX8, Transcription factor SOX-8) (APC)

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) MAP70.3 Polyclonal Antibody
MBS7143118 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) MAP70.3 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse 6030498E09Rik qPCR Primer Pair
QM45846S 200 Tests

Mouse 6030498E09Rik qPCR Primer Pair

Sign In for Pricing
View Details
Il6, Recombinant, Rat, aa25-211, His-Tag (Interleukin 6, Ifnb2, ILg6)
396890-01 5 µg

Il6, Recombinant, Rat, aa25-211, His-Tag (Interleukin 6, Ifnb2, ILg6)

Sign In for Pricing
View Details