Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFER, Human (HEK293, His)

GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GFER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfer-protein-human-hek293-c-his.html

Purity

96.00

Smiles

MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Molecular Formula

2671 (Gene_ID) P55789-2 (M1-D125) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rho GTPase-activating protein 36, CT (ARHGAP36, RP13-102H20.1) (MaxLight 550)
MBS6341913-01 0.1 mL

Rho GTPase-activating protein 36, CT (ARHGAP36, RP13-102H20.1) (MaxLight 550)

Sign In for Pricing
View Details
Rho GTPase-activating protein 36, CT (ARHGAP36, RP13-102H20.1) (MaxLight 550)
MBS6341913-02 5x 0.1 mL

Rho GTPase-activating protein 36, CT (ARHGAP36, RP13-102H20.1) (MaxLight 550)

Sign In for Pricing
View Details
Canine Total Protein S, TPS GENLISA ELISA
KLN0167 96 Well

Canine Total Protein S, TPS GENLISA ELISA

Sign In for Pricing
View Details
Mouse Monoclonal SLC44A2 Antibody (1D5)
H00057153-M02 0.1 mg

Mouse Monoclonal SLC44A2 Antibody (1D5)

Sign In for Pricing
View Details
NGI-1 50mg
A18706-50 50 mg

NGI-1 50mg

Sign In for Pricing
View Details
Recombinant Bovine Dermatan-sulfate epimerase (DSE) , partial
MBS962610-01 1 mg (E-Coli)

Recombinant Bovine Dermatan-sulfate epimerase (DSE) , partial

Sign In for Pricing
View Details