GFER, Human (HEK293, His)
GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
GFER Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gfer-protein-human-hek293-c-his.html
Purity
96.00
Smiles
MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD
Molecular Formula
2671 (Gene_ID) P55789-2 (M1-D125) (Accession)
Molecular Weight
Approximately 16 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
TL310360V 500 µL Each
PLEKHB2 Human shRNA Lentiviral Particle (Locus ID 55041)
Sign In for Pricing
View Details MAB7442AF647 100 µL
Rabbit Monoclonal TL1A/TNFSF15 Antibody (2116C) [Alexa Fluor 647]
Sign In for Pricing
View Details 
TL517570V 500 µL Each
Iqgap3 Mouse shRNA Lentiviral Particle (Locus ID 404710)
Sign In for Pricing
View Details 
GTR15166640 1 Vial
Lentiviral mouse Lpcat2b shRNA (UAS) - Lentiviral mouseLpcat2b shRNA (UAS, GFP) (25)
Sign In for Pricing
View Details LV721113 1.0 µg DNA
CHED1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
Sign In for Pricing
View Details