Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFER, Human (HEK293, His)

GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GFER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfer-protein-human-hek293-c-his.html

Purity

96.00

Smiles

MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Molecular Formula

2671 (Gene_ID) P55789-2 (M1-D125) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goal anti-Syrian Hamster IgG Heavy and Light Chain Cross-Adsorbed Antibody FITC Conjugated
Al40-201F 0.5 mg

Goal anti-Syrian Hamster IgG Heavy and Light Chain Cross-Adsorbed Antibody FITC Conjugated

Sign In for Pricing
View Details
ELISA kit for Bovine Protein phosphatase 1 regulatory subunit 1B (PPP1R1B)
KTE10195-01 48 Tests

ELISA kit for Bovine Protein phosphatase 1 regulatory subunit 1B (PPP1R1B)

Sign In for Pricing
View Details
ELISA kit for Bovine Protein phosphatase 1 regulatory subunit 1B (PPP1R1B)
KTE10195-02 96 Tests

ELISA kit for Bovine Protein phosphatase 1 regulatory subunit 1B (PPP1R1B)

Sign In for Pricing
View Details
ELISA kit for Bovine Protein phosphatase 1 regulatory subunit 1B (PPP1R1B)
KTE10195-03 5x 96 Well

ELISA kit for Bovine Protein phosphatase 1 regulatory subunit 1B (PPP1R1B)

Sign In for Pricing
View Details
Mouse Monoclonal KIF2C Antibody (KIF2C/4707) [DyLight 405]
NBP3-20783V 0.1 mL

Mouse Monoclonal KIF2C Antibody (KIF2C/4707) [DyLight 405]

Sign In for Pricing
View Details
Klk1b26 sgRNA CRISPR Lentivector set (Mouse)
K3288801 3x 1.0 µg

Klk1b26 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details