Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFER, Human (HEK293, His)

GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GFER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfer-protein-human-hek293-c-his.html

Purity

96.00

Smiles

MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Molecular Formula

2671 (Gene_ID) P55789-2 (M1-D125) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1307041 ORF Vector (Rat) (pORF)
38990016 1.0 µg DNA

RGD1307041 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Magic™ Membrane Protein Human GASK1B (Golgi associated kinase 1B) for Antibody Discovery
MP0351X Each

Magic™ Membrane Protein Human GASK1B (Golgi associated kinase 1B) for Antibody Discovery

Sign In for Pricing
View Details
EDG2 (LPAR1) (NM_057159) Human Tagged ORF Clone
RC206066 10 µg

EDG2 (LPAR1) (NM_057159) Human Tagged ORF Clone

Sign In for Pricing
View Details
HTF9C (TRMT2A) Mouse Monoclonal Antibody [Clone ID: OTI3D8]
CF505517 100 µg

HTF9C (TRMT2A) Mouse Monoclonal Antibody [Clone ID: OTI3D8]

Sign In for Pricing
View Details
Human TNFSF11/RANKL (Tumor necrosis factor ligand superfamily member 11) ELISA Kit
EH0313-CM 96 Tests

Human TNFSF11/RANKL (Tumor necrosis factor ligand superfamily member 11) ELISA Kit

Sign In for Pricing
View Details
MEK2 Rabbit Polyclonal Antibody(F189)
RA20166-01 50 µL

MEK2 Rabbit Polyclonal Antibody(F189)

Sign In for Pricing
View Details