GFER, Human (HEK293, His)

GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GFER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfer-protein-human-hek293-c-his.html

Purity

96.00

Smiles

MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Molecular Formula

2671 (Gene_ID) P55789-2 (M1-D125) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP1-51523PEATT594 0.5 mL

Mouse Monoclonal Mouse anti-Human IgG Secondary Antibody (4D2D9G8) [PE/Atto594]

View Details

TU257748 1.0 mL

LOC100360876 3'UTR GFP Stable Cell Line

View Details

abx113255 100 µL

Interleukin 5 Receptor alpha (IL5RA) Antibody

View Details

GB114013 100 μL

Anti-LARP7 Rabbit pAb

View Details

MBS6357410-01 0.2 mL

TOR1A, CT (TOR1A, DQ2, DYT1, Torsin-1A, Dystonia 1 protein, Torsin family 1 member A) (Azide free) (HRP)

View Details

MBS6357410-02 5x 0.2 mL

TOR1A, CT (TOR1A, DQ2, DYT1, Torsin-1A, Dystonia 1 protein, Torsin family 1 member A) (Azide free) (HRP)

View Details