Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFER, Human (HEK293, His)

GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GFER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfer-protein-human-hek293-c-his.html

Purity

96.00

Smiles

MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Molecular Formula

2671 (Gene_ID) P55789-2 (M1-D125) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal IL-6R alpha Antibody (17506) [HRP]
FAB227H 0.1 mL

Mouse Monoclonal IL-6R alpha Antibody (17506) [HRP]

Sign In for Pricing
View Details
Recombinant Human FAM171B / KIAA1946 Protein (Fc tag)
E53A06874 50 µg

Recombinant Human FAM171B / KIAA1946 Protein (Fc tag)

Sign In for Pricing
View Details
Tridemorph
MBS5812171 Inquire

Tridemorph

Sign In for Pricing
View Details
Phf5a Mouse siRNA Oligo Duplex (Locus ID 68479)
SR401425 1 Kit

Phf5a Mouse siRNA Oligo Duplex (Locus ID 68479)

Sign In for Pricing
View Details
Rbks sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6046708 1.0 µg DNA

Rbks sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Mouse Lipase, Hormone Sensitive (LIPE) ELISA Kit
RD-LIPE-Mu-01 96 Tests

Mouse Lipase, Hormone Sensitive (LIPE) ELISA Kit

Sign In for Pricing
View Details