Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFER, Human (HEK293, His)

GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GFER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfer-protein-human-hek293-c-his.html

Purity

96.00

Smiles

MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Molecular Formula

2671 (Gene_ID) P55789-2 (M1-D125) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ZNF537 Antibody [Alexa Fluor 405]
NBP2-81880AF405 0.1 mL

Rabbit Polyclonal ZNF537 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
FFPE Tissue Blocks, Endometrium
CB704544 1 Block

FFPE Tissue Blocks, Endometrium

Sign In for Pricing
View Details
PECMV-FAM177A1 (human) -Linker-3xFLAG-SV40-Neo
BZ36627 1 Vial

PECMV-FAM177A1 (human) -Linker-3xFLAG-SV40-Neo

Sign In for Pricing
View Details
Zfp128 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4203907 1.0 µg DNA

Zfp128 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Probable Allantoicase (ALLC) Antibody
abx110940 100 µL

Probable Allantoicase (ALLC) Antibody

Sign In for Pricing
View Details
Trifloxystrobin 10mM * 1mL in DMSO
A13183-10mM-D 10 mM x 1mL in DMSO

Trifloxystrobin 10mM * 1mL in DMSO

Sign In for Pricing
View Details