Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFER, Human (HEK293, His)

GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GFER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfer-protein-human-hek293-c-his.html

Purity

96.00

Smiles

MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Molecular Formula

2671 (Gene_ID) P55789-2 (M1-D125) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cadm1 (NM_207676) Mouse Tagged ORF Clone
MG222735 10 µg

Cadm1 (NM_207676) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Marburg Virus (FM44)
sc-52069 100 µg/mL

Marburg Virus (FM44)

Sign In for Pricing
View Details
D16Ertd472e sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4614004 1.0 µg DNA

D16Ertd472e sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
CISD3 Protein Vector (Rat) (pPM-C-His)
PV260137 500 ng

CISD3 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Trappc1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
47511116 3x 1.0 µg

Trappc1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Test Tube
D11 15x 100 - PS

Test Tube

Sign In for Pricing
View Details