GFER, Human (HEK293, His)
GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
GFER Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gfer-protein-human-hek293-c-his.html
Purity
96.00
Smiles
MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD
Molecular Formula
2671 (Gene_ID) P55789-2 (M1-D125) (Accession)
Molecular Weight
Approximately 16 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
E28PE0452 100 µL
CYP1A2 (Cytochrome P450 1A2) (14L1) Mouse Monoclonal antibody
Sign In for Pricing
View Details 
GTR15247317 1 Vial
Lentiviral mouse Lbhd2 shRNA (UAS) - Lentiviral mouse Lbhd2 shRNA (UAS, GFP) (100)
Sign In for Pricing
View Details 
![Rabbit Polyclonal Histone H3 [ac Lys9 ac Lys14] Antibody [Alexa Fluor 405]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
NB21-1081AF405 0.05 mL
Rabbit Polyclonal Histone H3 [ac Lys9 ac Lys14] Antibody [Alexa Fluor 405]
Sign In for Pricing
View Details