Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFER, Human (HEK293, His)

GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GFER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfer-protein-human-hek293-c-his.html

Purity

96.00

Smiles

MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Molecular Formula

2671 (Gene_ID) P55789-2 (M1-D125) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGS6 (NM_001204418) Human Tagged ORF Clone
RC234184 10 µg

RGS6 (NM_001204418) Human Tagged ORF Clone

Sign In for Pricing
View Details
Factor D Protein (C-His, Mouse)
P515056 100 µg

Factor D Protein (C-His, Mouse)

Sign In for Pricing
View Details
Rabbit Polyclonal MORN2 Antibody [DyLight 550]
NBP2-98023R 0.1 mL

Rabbit Polyclonal MORN2 Antibody [DyLight 550]

Sign In for Pricing
View Details
ARL3, CT (ADP-ribosylation Factor-like Protein 3, ARFL3) (MaxLight 405)
MBS6464027-01 0.1 mL

ARL3, CT (ADP-ribosylation Factor-like Protein 3, ARFL3) (MaxLight 405)

Sign In for Pricing
View Details
ARL3, CT (ADP-ribosylation Factor-like Protein 3, ARFL3) (MaxLight 405)
MBS6464027-02 5x 0.1 mL

ARL3, CT (ADP-ribosylation Factor-like Protein 3, ARFL3) (MaxLight 405)

Sign In for Pricing
View Details
Human Hepatobiliary Cancer Cells [RBE]
AFG-ELL-0176 > 1x 10^6 Cells / Vial

Human Hepatobiliary Cancer Cells [RBE]

Sign In for Pricing
View Details