GFER, Human (HEK293, His)
GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
GFER Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gfer-protein-human-hek293-c-his.html
Purity
96.00
Smiles
MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD
Molecular Formula
2671 (Gene_ID) P55789-2 (M1-D125) (Accession)
Molecular Weight
Approximately 16 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1193207-01 1 mg (E-Coli)
Recombinant Ajellomyces capsulata Vacuolar protein sorting/targeting protein 10 (VPS10), partial
Sign In for Pricing
View Details 
MBS1193207-02 1 mg (Yeast)
Recombinant Ajellomyces capsulata Vacuolar protein sorting/targeting protein 10 (VPS10), partial
Sign In for Pricing
View Details MBS7275204-01 48 Well
Chicken anti-Zona Pellucida Glycoprotein 2 Antibody ELISA Kit
Sign In for Pricing
View Details 
MBS7275204-02 96 Well
Chicken anti-Zona Pellucida Glycoprotein 2 Antibody ELISA Kit
Sign In for Pricing
View Details