Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFER, Human (HEK293, His)

GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GFER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfer-protein-human-hek293-c-his.html

Purity

96.00

Smiles

MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Molecular Formula

2671 (Gene_ID) P55789-2 (M1-D125) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARH (LDLRAP1) Mouse Monoclonal Antibody [Clone ID: OTI7E11]
TA503854 100 µL

ARH (LDLRAP1) Mouse Monoclonal Antibody [Clone ID: OTI7E11]

Sign In for Pricing
View Details
GART (Trifunctional Purine Biosynthetic Protein Adenosine-3, PGFT, PRGS, MGC47764) (APC)
127171-APC 100 µL

GART (Trifunctional Purine Biosynthetic Protein Adenosine-3, PGFT, PRGS, MGC47764) (APC)

Sign In for Pricing
View Details
(R)-Cetirizine N-Oxide
TRC-C281115-100MG 100 mg

(R)-Cetirizine N-Oxide

Sign In for Pricing
View Details
Human C2 siRNA
abx909813-01 15 nmol

Human C2 siRNA

Sign In for Pricing
View Details
Human C2 siRNA
abx909813-02 30 nmol

Human C2 siRNA

Sign In for Pricing
View Details
CRYZL1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F9]
TA504659AM 100 µL

CRYZL1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F9]

Sign In for Pricing
View Details