Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFER, Human (HEK293, His)

GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GFER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfer-protein-human-hek293-c-his.html

Purity

96.00

Smiles

MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Molecular Formula

2671 (Gene_ID) P55789-2 (M1-D125) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

H-D-Phe-OBzl·HCl
5-03282 100 g

H-D-Phe-OBzl·HCl

Sign In for Pricing
View Details
Rabbit Polyclonal E2F7 Antibody [Alexa Fluor 700]
NBP1-52648AF700 0.1 mL

Rabbit Polyclonal E2F7 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Human Cell cycle control protein 50B (TMEM30B) ELISA Kit
MBS7248472-01 48 Well

Human Cell cycle control protein 50B (TMEM30B) ELISA Kit

Sign In for Pricing
View Details
Human Cell cycle control protein 50B (TMEM30B) ELISA Kit
MBS7248472-02 96 Well

Human Cell cycle control protein 50B (TMEM30B) ELISA Kit

Sign In for Pricing
View Details
Human Cell cycle control protein 50B (TMEM30B) ELISA Kit
MBS7248472-03 5x 96 Well

Human Cell cycle control protein 50B (TMEM30B) ELISA Kit

Sign In for Pricing
View Details
Human Cell cycle control protein 50B (TMEM30B) ELISA Kit
MBS7248472-04 10x 96 Well

Human Cell cycle control protein 50B (TMEM30B) ELISA Kit

Sign In for Pricing
View Details