Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFER, Human (HEK293, His)

GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GFER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfer-protein-human-hek293-c-his.html

Purity

96.00

Smiles

MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Molecular Formula

2671 (Gene_ID) P55789-2 (M1-D125) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Boc-Val-Pro-Arg-MCA TFA
MBS5820075 Inquire

Boc-Val-Pro-Arg-MCA TFA

Sign In for Pricing
View Details
Mouse Monoclonal DOCK2 Antibody (OTI7G2) [Biotin]
NBP2-70583B 0.1 mL

Mouse Monoclonal DOCK2 Antibody (OTI7G2) [Biotin]

Sign In for Pricing
View Details
3-Chloro-5-nitrobenzoic acid
425085-01 100 mg

3-Chloro-5-nitrobenzoic acid

Sign In for Pricing
View Details
3-Chloro-5-nitrobenzoic acid
425085-02 250 mg

3-Chloro-5-nitrobenzoic acid

Sign In for Pricing
View Details
SPIN1 Antibody
A35526-100UL 100 µL

SPIN1 Antibody

Sign In for Pricing
View Details
1- (3,4-Difluoro-phenyl) -piperidin-4-one
407907-01 25 mg

1- (3,4-Difluoro-phenyl) -piperidin-4-one

Sign In for Pricing
View Details