Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-20, Human (His)

IL-20 protein is a proinflammatory cytokine secreted by monocytes and keratinocytes that is critical for immune responses, inflammation, hematopoiesis, and epidermal cell differentiation. It plays a key role in tissue remodeling, wound healing, and maintenance of epithelial homeostasis during infection. Animal-Free IL-20 Protein, Human (His) is the recombinant human-derived animal-FreeIL-20 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-20 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-20-protein-human-his.html

Purity

95.0

Smiles

MLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE

Molecular Formula

50604 (Gene_ID) Q9NYY1-1 (L25-E176) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Lotus japonicus Ras-related protein Rab11C (RAB11C)
MBS1407995-01 0.02 mg (E-Coli)

Recombinant Lotus japonicus Ras-related protein Rab11C (RAB11C)

Sign In for Pricing
View Details
Recombinant Lotus japonicus Ras-related protein Rab11C (RAB11C)
MBS1407995-02 0.1 mg (E-Coli)

Recombinant Lotus japonicus Ras-related protein Rab11C (RAB11C)

Sign In for Pricing
View Details
Recombinant Lotus japonicus Ras-related protein Rab11C (RAB11C)
MBS1407995-03 0.02 mg (Yeast)

Recombinant Lotus japonicus Ras-related protein Rab11C (RAB11C)

Sign In for Pricing
View Details
Recombinant Lotus japonicus Ras-related protein Rab11C (RAB11C)
MBS1407995-04 0.1 mg (Yeast)

Recombinant Lotus japonicus Ras-related protein Rab11C (RAB11C)

Sign In for Pricing
View Details
Recombinant Lotus japonicus Ras-related protein Rab11C (RAB11C)
MBS1407995-05 0.02 mg (Baculovirus)

Recombinant Lotus japonicus Ras-related protein Rab11C (RAB11C)

Sign In for Pricing
View Details
Recombinant Lotus japonicus Ras-related protein Rab11C (RAB11C)
MBS1407995-06 0.02 mg (Mammalian-Cell)

Recombinant Lotus japonicus Ras-related protein Rab11C (RAB11C)

Sign In for Pricing
View Details