Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human IL12B&IL12A Heterodimer Protein (Active)

Product Specifications

Product Name Alternative

(Cytotoxic lymphocyte maturation factor) (CLMF) (IL-12) (NK cell stimulatory factor) (NKSF)

Abbreviation

Recombinant Human IL12B&IL12A Heterodimer protein (Active)

Gene Name

IL12B&IL12A

UniProt

P29460 & P29459

Expression Region

23-328aa (IL12B) &23-219aa (IL12A)

Organism

Homo sapiens (Human)

Target Sequence

IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS&RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS

Tag

C-terminal 10xHis-tagged & C-terminal Flag-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human IL12B&IL12A at 1 μg/ml/mL can bind Anti-IL12/IL23 recombinant antibody (CSB-RA011587MA1HU), the EC50 is 1.042-1.545 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

39.7 kDa & 27.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Heterodimer

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Pramef12 shRNA (UAS) - Lentiviral mouse Pramef12 shRNA (UAS, RFP) plasmid
GTR15226741 1 Vial

Lentiviral mouse Pramef12 shRNA (UAS) - Lentiviral mouse Pramef12 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Cdkl4 Mouse Gene Knockout Kit (CRISPR)
KN503056 1 Kit

Cdkl4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NAD+ 5g
A11679-5000 5000 mg

NAD+ 5g

Sign In for Pricing
View Details
SLC16A7 Rabbit Polyclonal Antibody (FITC)
orb2120070 100 µL

SLC16A7 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Cdk9 Monoclonal Antibody, PE-Cy7 Conjugated
bsm-52033R-PE-Cy7 100 µL

Cdk9 Monoclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Anti-HKDC1 Antibody Picoband® (Cy3 Conjugate)
PB9375-Cy3 100 µg/Vial

Anti-HKDC1 Antibody Picoband® (Cy3 Conjugate)

Sign In for Pricing
View Details