Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Haptoglobin (Hp)

Product Specifications

Abbreviation

Recombinant Mouse Haptoglobin protein

Gene Name

Hp

UniProt

Q61646

Expression Region

19-347aa

Organism

Mus musculus (Mouse)

Target Sequence

VELGNDAMDFEDDSCPKPPEIANGYVEHLVRYRCRQFYRLRAEGDGVYTLNDEKQWVNTVAGEKLPECEAVCGKPKHPVDQVQRIIGGSMDAKGSFPWQAKMISRHGLTTGATLISDQWLLTTAKNLFLNHSETASAKDITPTLTLYVGKNQLVEIEKVVLHPNHSVVDIGLIKLKQRVLVTERVMPICLPSKDYIAPGRVGYVSGWGRNANFRFTDRLKYVMLPVADQDKCVVHYENSTVPEKKNLTSPVGVQPILNEHTFCAGLTKYQEDTCYGDAGSAFAIHDMEEDTWYAAGILSFDKSCAVAEYGVYVRATDLKDWVQETMAKN

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

As a result of hemolysis, hemoglobin is found to accumulate in the kidney and is secreted in the urine. Haptoglobin captures, and combines with free plasma hemoglobin to allow hepatic recycling of heme iron and to prevent kidney damage. Haptoglobin also acts as an antioxidant, has antibacterial activity and plays a role in modulating many aspects of the acute phase response. Hemoglobin/haptoglobin complexes are rapidly cleared by the macrophage CD163 scavenger receptor expressed on the surface of liver Kupfer cells through an endocytic lysosomal degradation pathway .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

40.9 kDa

References & Citations

"Enhanced splenomegaly and severe liver inflammation in haptoglobin/hemopexin double-null mice after acute hemolysis." Tolosano E., Fagoonee S., Hirsch E., Berger F.G., Baumann H., Silengo L., Altruda F. Blood 100:4201-4208 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse anti Human HLA Class I Heavy Chain (Restricted expression)
MBS570339-01 0.1 mg

Mouse anti Human HLA Class I Heavy Chain (Restricted expression)

Sign In for Pricing
View Details
Mouse anti Human HLA Class I Heavy Chain (Restricted expression)
MBS570339-02 5x 0.1 mg

Mouse anti Human HLA Class I Heavy Chain (Restricted expression)

Sign In for Pricing
View Details
Recombinant TMEV-2A
P9685-01 50 µg

Recombinant TMEV-2A

Sign In for Pricing
View Details
Recombinant TMEV-2A
P9685-02 200 µg

Recombinant TMEV-2A

Sign In for Pricing
View Details
Recombinant TMEV-2A
P9685-03 1 mg

Recombinant TMEV-2A

Sign In for Pricing
View Details
GRAP Human qPCR Template Standard (NM_006613)
HK203522 1 Kit

GRAP Human qPCR Template Standard (NM_006613)

Sign In for Pricing
View Details