Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mucuna pruriens Cysteine proteinase mucunain (MUCUNAIN)

Product Specifications

CAS Number

9000-83-3

Gene Name

MUCUNAIN

UniProt

B2LSD2

Expression Region

101-317aa

Organism

Mucuna pruriens (Velvet bean) (Dolichos pruriens)

Target Sequence

LPESVDWRNESAVLPVKDQGNCGSCWAFSTIGAVEGINKIVTGDLISLSEQELVDCDTSYNQGCNGGLMDYAYEFIINNGGIDSEEDYPYRAVDGTCDQYRKNAKVVTIDSYEDVPANDELALKKAVANQPVSVAIEGGGREFQLYVSGVFTGRCGTALDHGVVAVGYGSVKGHDYWIVRNSWGASWGEEGYVRLERNLAKSRSGKCGIAIEPSYPI

Tag

N-terminal 10xHis-tagged

Source

E.coli

Field of Research

Others

Assay Type

Developed Protein

Relevance

Cysteine protease. May play a role in immunity, senescence, and biotic and abiotic stresses.

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Length

Full Length of Mature Protein

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

29.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DFFB Human shRNA Plasmid Kit (Locus ID 1677)
TR313500 1 Kit

DFFB Human shRNA Plasmid Kit (Locus ID 1677)

Sign In for Pricing
View Details
NPFFR1 (NPFF1, Neuropeptide FF1, NPFF-1, NPFF 1) (PE)
301431-PE 100 µL

NPFFR1 (NPFF1, Neuropeptide FF1, NPFF-1, NPFF 1) (PE)

Sign In for Pricing
View Details
PCB (PC) (NM_001040716) Human Tagged ORF Clone Lentiviral Particle
RC221952L1V 200 µL

PCB (PC) (NM_001040716) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Niemann Pick C1 Protein (NPC1) ELISA Kit
MBS9359322-01 48 Well

Mouse Niemann Pick C1 Protein (NPC1) ELISA Kit

Sign In for Pricing
View Details
Mouse Niemann Pick C1 Protein (NPC1) ELISA Kit
MBS9359322-02 96 Well

Mouse Niemann Pick C1 Protein (NPC1) ELISA Kit

Sign In for Pricing
View Details
Mouse Niemann Pick C1 Protein (NPC1) ELISA Kit
MBS9359322-03 5x 96 Well

Mouse Niemann Pick C1 Protein (NPC1) ELISA Kit

Sign In for Pricing
View Details