Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-19, Human

IL-19 Protein, Human is a member of the Interleukin-10 family. The biological functions and clinical implications of Interleukin-19 is still undefined.

Product Specifications

Product Name Alternative

IL-19 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

COVID-19-immunoregulation

Assay Protocol

https://www.medchemexpress.com/cytokines/il-19-protein-human.html

Purity

95.0

Smiles

LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMSSA

Molecular Formula

29949 (Gene_ID) Q9UHD0-1 (L25-A177) (Accession)

Molecular Weight

Approximately 17.9 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Gallagher G, et al. Cloning, expression and initial characterization of interleukin-19 (IL-19), a novel homologue of human interleukin-10 (IL-10) . Genes Immun. 2000 Oct;1 (7) :442-50.|[2]Gallagher G, et al. Interleukin-19: multiple roles in immune regulation and disease. Cytokine Growth Factor Rev. 2010 Oct;21 (5) :345-52.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acetamidine Hydrochloride
TRC-A133070-1G 1 g

Acetamidine Hydrochloride

Sign In for Pricing
View Details
Blood Group Antigen B (CD173) (HEB-20), CF568 conjugate, 0.1mg/mL
BNC680296-500 1x 500 µL

Blood Group Antigen B (CD173) (HEB-20), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SHPRH Antibody
KC-2817-01 50 μL

SHPRH Antibody

Sign In for Pricing
View Details
SHPRH Antibody
KC-2817-02 100 µL

SHPRH Antibody

Sign In for Pricing
View Details
SHPRH Antibody
KC-2817-03 1 mL

SHPRH Antibody

Sign In for Pricing
View Details
Melanoma Marker (HMB45 + A103 + T311), CF405S conjugate, 0.1mg/mL
BNC040702-100 1x 100 µL

Melanoma Marker (HMB45 + A103 + T311), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details