Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-19, Human

IL-19 Protein, Human is a member of the Interleukin-10 family. The biological functions and clinical implications of Interleukin-19 is still undefined.

Product Specifications

Product Name Alternative

IL-19 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

COVID-19-immunoregulation

Assay Protocol

https://www.medchemexpress.com/cytokines/il-19-protein-human.html

Purity

95.0

Smiles

LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMSSA

Molecular Formula

29949 (Gene_ID) Q9UHD0-1 (L25-A177) (Accession)

Molecular Weight

Approximately 17.9 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Gallagher G, et al. Cloning, expression and initial characterization of interleukin-19 (IL-19), a novel homologue of human interleukin-10 (IL-10) . Genes Immun. 2000 Oct;1 (7) :442-50.|[2]Gallagher G, et al. Interleukin-19: multiple roles in immune regulation and disease. Cytokine Growth Factor Rev. 2010 Oct;21 (5) :345-52.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Taz Mouse Gene Knockout Kit (CRISPR)
KN517231 1 Kit

Taz Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Polystyrene A FMP
HA12516008.100G 100 g

Polystyrene A FMP

Sign In for Pricing
View Details
CEACAM5 Mouse Monoclonal Antibody [Clone ID: COL-1]
AM32833PU-S 100 µg

CEACAM5 Mouse Monoclonal Antibody [Clone ID: COL-1]

Sign In for Pricing
View Details
Polystyrene A CHO
HA16020006.100G 100 g

Polystyrene A CHO

Sign In for Pricing
View Details
MTFMT Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E7]
TA503565BM 100 µL

MTFMT Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E7]

Sign In for Pricing
View Details
Solution Reservoir
P8025-1S 100 Units/Case

Solution Reservoir

Sign In for Pricing
View Details