Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-19, Human

IL-19 Protein, Human is a member of the Interleukin-10 family. The biological functions and clinical implications of Interleukin-19 is still undefined.

Product Specifications

Product Name Alternative

IL-19 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

COVID-19-immunoregulation

Assay Protocol

https://www.medchemexpress.com/cytokines/il-19-protein-human.html

Purity

95.0

Smiles

LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMSSA

Molecular Formula

29949 (Gene_ID) Q9UHD0-1 (L25-A177) (Accession)

Molecular Weight

Approximately 17.9 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Gallagher G, et al. Cloning, expression and initial characterization of interleukin-19 (IL-19), a novel homologue of human interleukin-10 (IL-10) . Genes Immun. 2000 Oct;1 (7) :442-50.|[2]Gallagher G, et al. Interleukin-19: multiple roles in immune regulation and disease. Cytokine Growth Factor Rev. 2010 Oct;21 (5) :345-52.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPP38 (NM_006414) Human Tagged ORF Clone Lentiviral Particle
RC206032L3V 200 µL

RPP38 (NM_006414) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
IFT57 cDNA Clone
MBS1272661-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

IFT57 cDNA Clone

Sign In for Pricing
View Details
IFT57 cDNA Clone
MBS1272661-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

IFT57 cDNA Clone

Sign In for Pricing
View Details
Tet oncogene family member 2
336886 100 µL

Tet oncogene family member 2

Sign In for Pricing
View Details
PPA1 Rabbit Polyclonal Antibody (FITC)
orb2114454 100 µL

PPA1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
FGF-17 (B-4) : m-IgG Fc BP-HRP Bundle
sc-527504 1 Kit

FGF-17 (B-4) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details