Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-4, Bovine

IL-4 Protein, a key participant in B-cell activation and various cell types, acts as a costimulator of DNA synthesis. It induces class II MHC molecules on B-cells, enhances IgE and IgG1 secretion and expression, and regulates CD23 on lymphocytes and monocytes. IL-4 positively regulates IL31RA in macrophages and stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and inducing RUFY4. IL-4 Protein, Bovine is the recombinant bovine-derived IL-4 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-4 Protein, Bovine, Bovine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-4-protein-bovine.html

Purity

97.00

Smiles

HKCDITLAEIIKTLNILTTRKNSCMELPVADVFAAPKNTTEKETFCRVGIELRRIYRSHTCLNKFLGGLDRNLNSLASKTCSVNEAKTSTSTLKDLLERLKTIMKEKYSKC

Molecular Formula

280824 (Gene_ID) P30367 (H25-C135) (Accession)

Molecular Weight

Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Collagen Type II Alpha 1 (COL2a1)
MBS2012028-01 0.01 mg

Recombinant Collagen Type II Alpha 1 (COL2a1)

Ask
View Details
Recombinant Collagen Type II Alpha 1 (COL2a1)
MBS2012028-02 0.05 mg

Recombinant Collagen Type II Alpha 1 (COL2a1)

Ask
View Details
Recombinant Collagen Type II Alpha 1 (COL2a1)
MBS2012028-03 0.1 mg

Recombinant Collagen Type II Alpha 1 (COL2a1)

Ask
View Details
Recombinant Collagen Type II Alpha 1 (COL2a1)
MBS2012028-04 0.2 mg

Recombinant Collagen Type II Alpha 1 (COL2a1)

Ask
View Details
Recombinant Collagen Type II Alpha 1 (COL2a1)
MBS2012028-05 0.5 mg

Recombinant Collagen Type II Alpha 1 (COL2a1)

Ask
View Details
Recombinant Collagen Type II Alpha 1 (COL2a1)
MBS2012028-06 1 mg

Recombinant Collagen Type II Alpha 1 (COL2a1)

Ask
View Details