IL-4, Bovine
IL-4 Protein, a key participant in B-cell activation and various cell types, acts as a costimulator of DNA synthesis. It induces class II MHC molecules on B-cells, enhances IgE and IgG1 secretion and expression, and regulates CD23 on lymphocytes and monocytes. IL-4 positively regulates IL31RA in macrophages and stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and inducing RUFY4. IL-4 Protein, Bovine is the recombinant bovine-derived IL-4 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
IL-4 Protein, Bovine, Bovine, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-4-protein-bovine.html
Purity
97.00
Smiles
HKCDITLAEIIKTLNILTTRKNSCMELPVADVFAAPKNTTEKETFCRVGIELRRIYRSHTCLNKFLGGLDRNLNSLASKTCSVNEAKTSTSTLKDLLERLKTIMKEKYSKC
Molecular Formula
280824 (Gene_ID) P30367 (H25-C135) (Accession)
Molecular Weight
Approximately 12 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
Lentiviral mouse Dcun1d4 shRNA (UAS) - Lentiviral mouse Dcun1d4 shRNA (UAS) plasmid