Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin D, Human (HEK293, His)

Cathepsin D protein is an acidic protease that actively participates in intracellular protein breakdown. Studies have shown that it is critical in the processing of amyloid precursor protein (APP), with ADAM30-mediated cleavage and activation leading to APP degradation. Cathepsin D Protein, Human (HEK293, His) is the recombinant human-derived Cathepsin D protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Cathepsin D Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-d-protein-human-hek293-c-his.html

Purity

95.49

Smiles

LVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARLHHHHHH

Molecular Formula

1509 (Gene_ID) P07339 (L21-L412) (Accession)

Molecular Weight

Approximately 44.78 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Thromboxane A2 receptor (TBXA2R), partial
MBS7057258-01 0.02 mg (E-Coli)

Recombinant Human Thromboxane A2 receptor (TBXA2R), partial

Sign In for Pricing
View Details
Recombinant Human Thromboxane A2 receptor (TBXA2R), partial
MBS7057258-02 0.1 mg (E-Coli)

Recombinant Human Thromboxane A2 receptor (TBXA2R), partial

Sign In for Pricing
View Details
Recombinant Human Thromboxane A2 receptor (TBXA2R), partial
MBS7057258-03 0.02 mg (Yeast)

Recombinant Human Thromboxane A2 receptor (TBXA2R), partial

Sign In for Pricing
View Details
Recombinant Human Thromboxane A2 receptor (TBXA2R), partial
MBS7057258-04 0.1 mg (Yeast)

Recombinant Human Thromboxane A2 receptor (TBXA2R), partial

Sign In for Pricing
View Details
Recombinant Human Thromboxane A2 receptor (TBXA2R), partial
MBS7057258-05 0.02 mg (Baculovirus)

Recombinant Human Thromboxane A2 receptor (TBXA2R), partial

Sign In for Pricing
View Details
Recombinant Human Thromboxane A2 receptor (TBXA2R), partial
MBS7057258-06 1 mg (E-Coli)

Recombinant Human Thromboxane A2 receptor (TBXA2R), partial

Sign In for Pricing
View Details