Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin D, Human (HEK293, His)

Cathepsin D protein is an acidic protease that actively participates in intracellular protein breakdown. Studies have shown that it is critical in the processing of amyloid precursor protein (APP), with ADAM30-mediated cleavage and activation leading to APP degradation. Cathepsin D Protein, Human (HEK293, His) is the recombinant human-derived Cathepsin D protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Cathepsin D Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-d-protein-human-hek293-c-his.html

Purity

95.49

Smiles

LVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARLHHHHHH

Molecular Formula

1509 (Gene_ID) P07339 (L21-L412) (Accession)

Molecular Weight

Approximately 44.78 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CTHRC1 Antibody
NBP2-81744 0.1 mg

Rabbit Polyclonal CTHRC1 Antibody

Sign In for Pricing
View Details
(5Z)-5-Dodecenoic Acid
TRC-D535350-50MG 50 mg

(5Z)-5-Dodecenoic Acid

Sign In for Pricing
View Details
VCX3B (NM_001001888) Human Tagged Lenti ORF Clone
RC218667L4 10 µg

VCX3B (NM_001001888) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rat Ccdc89 Pre-designed siRNA Set B
SI202187B 1 Each

Rat Ccdc89 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Rabbit Polyclonal SLX4 Antibody [PE]
NBP1-28680PE 0.1 mL

Rabbit Polyclonal SLX4 Antibody [PE]

Sign In for Pricing
View Details
Lentiviral mouse Scn4a shRNA (UAS) - Lentiviral mouse Scn4a shRNA (UAS, iRFP) plasmid
GTR15169492 1 Vial

Lentiviral mouse Scn4a shRNA (UAS) - Lentiviral mouse Scn4a shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details