Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin D, Human (HEK293, His)

Cathepsin D protein is an acidic protease that actively participates in intracellular protein breakdown. Studies have shown that it is critical in the processing of amyloid precursor protein (APP), with ADAM30-mediated cleavage and activation leading to APP degradation. Cathepsin D Protein, Human (HEK293, His) is the recombinant human-derived Cathepsin D protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Cathepsin D Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-d-protein-human-hek293-c-his.html

Purity

95.49

Smiles

LVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARLHHHHHH

Molecular Formula

1509 (Gene_ID) P07339 (L21-L412) (Accession)

Molecular Weight

Approximately 44.78 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB22A CytoSection
TS409511P5 25 Slides

RAB22A CytoSection

Sign In for Pricing
View Details
Recombinant Brachypodium distachyon Protein psbN (psbN), partial
MBS1025969-01 0.5 mg (E-Coli)

Recombinant Brachypodium distachyon Protein psbN (psbN), partial

Sign In for Pricing
View Details
Recombinant Brachypodium distachyon Protein psbN (psbN), partial
MBS1025969-02 0.05 mg (Baculovirus)

Recombinant Brachypodium distachyon Protein psbN (psbN), partial

Sign In for Pricing
View Details
Recombinant Brachypodium distachyon Protein psbN (psbN), partial
MBS1025969-03 0.5 mg (Yeast)

Recombinant Brachypodium distachyon Protein psbN (psbN), partial

Sign In for Pricing
View Details
Recombinant Brachypodium distachyon Protein psbN (psbN), partial
MBS1025969-04 0.05 mg (Mammalian-Cell)

Recombinant Brachypodium distachyon Protein psbN (psbN), partial

Sign In for Pricing
View Details
Recombinant Brachypodium distachyon Protein psbN (psbN), partial
MBS1025969-05 1 mg (E-Coli)

Recombinant Brachypodium distachyon Protein psbN (psbN), partial

Sign In for Pricing
View Details