Recombinant Bovine Phosphotriesterase-related protein (PTER)

MSSLSGKVQTVLGLVEPGTLGRTLTHEHLTMTFDCCYYPPPPSHEAISKEPIIMKNLFWIQKNPYSHKENLQLNQETEAIKEELLDFKAKGGGALVENTTTGLSRDVRTLKWLAEETGVHIIAGAGFYVDATHSSETRAKSVEQLTDVLVNEILCGADGTSIKCGVIGEIGCSWPLTDSERKVLQATAHAQTQLGCPVIIHPGRNQSAPFQIIRVLQEAGGDISKTVMSHIDRTILDKKELLEFAQFGCYLEYDLFGTELFHYQFNPDIDMPNDNKRIKRVRLLVDEGYEDRILMAHDIHTKNRLTKYGGHGYSHILTNIVPKMLLRGITEGALDKILIENPKQWLTFK

Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.