Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GM-CSF, Mouse (CHO)

GM-CSF Protein, Mouse (CHO) is a hematopoietic growth factor and immune modulator.

Product Specifications

Product Name Alternative

GM-CSF Protein, Mouse (CHO), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gm-csf-protein-mouse-cho.html

Purity

97.20

Smiles

APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK

Molecular Formula

12981 (Gene_ID) Q14AD9 (A18-K141) (Accession)

Molecular Weight

Approximately 15-23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Shi Y, et al. Granulocyte-macrophage colony-stimulating factor (GM-CSF) and T-cell responses: what we do and don't know. Cell Res. 2006 Feb;16 (2) :126-33.|[2]Gasson JC, et al. Human granulocyte-macrophage colony-stimulating factor (GM-CSF) : regulation of expression. Prog Clin Biol Res. 1990;338:27-41.|[3]Gomez-Cambronero J, et al. Granulocyte-macrophage colony-stimulating factor is a chemoattractant cytokine for human neutrophils: involvement of the ribosomal p70 S6 kinase signaling pathway. J Immunol. 2003 Dec 15;171 (12) :6846-55.|[4]Shiomi A, et al. GM-CSF as a therapeutic target in autoimmune diseases. Inflamm Regen. 2016 Jul 5;36:8.|[5]van Nieuwenhuijze A, et al. GM-CSF as a therapeutic target in inflammatory diseases. Mol Immunol. 2013 Dec;56 (4) :675-82.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal HRAS like suppressor Antibody [DyLight 350]
NBP3-05960UV 0.1 mL

Rabbit Polyclonal HRAS like suppressor Antibody [DyLight 350]

Ask
View Details
Adipogenic Differentiation Medium for Human Adipose-Derived Mesenchymal Stem Cells
abx705191 400 mL

Adipogenic Differentiation Medium for Human Adipose-Derived Mesenchymal Stem Cells

Ask
View Details
Protein Kinase C, epsilon (PKCe) (AP) discontinued
P9103-20C-AP 100 µL

Protein Kinase C, epsilon (PKCe) (AP) discontinued

Ask
View Details
MED8 (Mediator Complex Subunit 8, ARC32, MGC17544, MGC19641)
248632 100 µg

MED8 (Mediator Complex Subunit 8, ARC32, MGC17544, MGC19641)

Ask
View Details
Human Rab-like protein 2B, RABL2B ELISA KIT
ELI-42822h 96 Tests

Human Rab-like protein 2B, RABL2B ELISA KIT

Ask
View Details