Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GM-CSF, Mouse (CHO)

GM-CSF Protein, Mouse (CHO) is a hematopoietic growth factor and immune modulator.

Product Specifications

Product Name Alternative

GM-CSF Protein, Mouse (CHO), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gm-csf-protein-mouse-cho.html

Purity

97.20

Smiles

APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK

Molecular Formula

12981 (Gene_ID) Q14AD9 (A18-K141) (Accession)

Molecular Weight

Approximately 15-23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Shi Y, et al. Granulocyte-macrophage colony-stimulating factor (GM-CSF) and T-cell responses: what we do and don't know. Cell Res. 2006 Feb;16 (2) :126-33.|[2]Gasson JC, et al. Human granulocyte-macrophage colony-stimulating factor (GM-CSF) : regulation of expression. Prog Clin Biol Res. 1990;338:27-41.|[3]Gomez-Cambronero J, et al. Granulocyte-macrophage colony-stimulating factor is a chemoattractant cytokine for human neutrophils: involvement of the ribosomal p70 S6 kinase signaling pathway. J Immunol. 2003 Dec 15;171 (12) :6846-55.|[4]Shiomi A, et al. GM-CSF as a therapeutic target in autoimmune diseases. Inflamm Regen. 2016 Jul 5;36:8.|[5]van Nieuwenhuijze A, et al. GM-CSF as a therapeutic target in inflammatory diseases. Mol Immunol. 2013 Dec;56 (4) :675-82.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CCDC136 (NM_022742) Human Over-expression Lysate
LY411574 100 µg

CCDC136 (NM_022742) Human Over-expression Lysate

Ask
View Details
SLMO2 (PRELID3B) CytoSection
TS401029P5 25 Slides

SLMO2 (PRELID3B) CytoSection

Ask
View Details
Frozen Tissue Sections, Lung
CS601602 5x 5 µm

Frozen Tissue Sections, Lung

Ask
View Details
OVA Conjugated Procollagen II C-Terminal Propeptide (PIICP)
SDPA286Mu21-01 10 µg

OVA Conjugated Procollagen II C-Terminal Propeptide (PIICP)

Ask
View Details
OVA Conjugated Procollagen II C-Terminal Propeptide (PIICP)
SDPA286Mu21-02 50 µg

OVA Conjugated Procollagen II C-Terminal Propeptide (PIICP)

Ask
View Details
OVA Conjugated Procollagen II C-Terminal Propeptide (PIICP)
SDPA286Mu21-03 200 µg

OVA Conjugated Procollagen II C-Terminal Propeptide (PIICP)

Ask
View Details